IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ How a single T cell receptor recognizes both self and foreign MHC. How a single T cell receptor recognizes both self and foreign MHC. Cell (0092-8674) 2007 imex curation Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. The description of the proteins used determiend from back references and this publication. kcgarcia@stanford.edu orchard Only protein-protein interactions 3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. The description of the proteins used determiend from back references and this publication. kcgarcia@stanford.edu Accepted 2007-DEC-22 by ORCHARD. Cell (0092-8674) 2007 orchard Only protein-protein interactions 3 imex curation How a single T cell receptor recognizes both self and foreign MHC. How a single T cell receptor recognizes both self and foreign MHC. Cell (0092-8674) 2007 imex curation Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. The description of the proteins used determiend from back references and this publication. kcgarcia@stanford.edu orchard Only protein-protein interactions 3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. kcgarcia@stanford.edu Accepted 2007-DEC-23 by ORCHARD. Cell (0092-8674) 2007 orchard Only protein-protein interactions 3 imex curation ha1l_mouse H-2 class I histocompatibility antigen, L-D alpha chain H2-L protein protein mouse Mus musculus Mouse MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLGEPRYISVGYVDNKEFVRFDSDAENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA A5EFDEE31177BF22 a2ntu7_mouse protein protein mouse Mus musculus Mouse MLLALLPVLGIHFVLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS 202557AD1A605E39 a2nty6_mouse protein protein mouse Mus musculus Mouse MSNTAFPDPAWNTTLLSWVALFLLGTKHMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGELGGFNQDTQYFGPGTRLLVL 4071AC8C0A490C60 q6p8i7_mouse Oxoglutarate dehydrogenase (succinyl-transferring) Ogdh protein protein mouse Mus musculus Mouse MHSPWWKHNLTSTNSWRTTWRCSLSSGHIRSGVTTLQNLILRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS FB2A8BE5588A06E2 tcr-mhc 1 6 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain V T Fri Jul 22 10:56:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile47thr,val36thr' Wed May 02 19:55:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val36thr,ile47thr' Tue Jun 30 20:10:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val36Thr;Ile47Thr]' extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table S1. working 22.4 percent, free 24.6 percent 2.50 A The protein H2-L had additional mutation F9Y (possibly F8 in UniProtKB entry) which increased solubility of the proteins. These residue posiiton however does not correspond with the UniProtKB entry. The cytotoxic T-cell receptor precursor described here has mutation in the linker V beta 8.2 region to increase solubility. The mutations described are gly17glu his47tyr iso75thr leu81ser tcr-mhc-1 1 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain V T certain certain sequence position certain certain certain sequence position certain I T Wed May 02 18:42:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val36thr,ile47thr' Tue Jun 30 19:59:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val36Thr;Ile47Thr]' extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table S1. Fig S2, S3 working 22.0 percent, free 22.6 percent 2.35 A Using these smaller, more stable versions of the TCR and pMHC, we were able to crystallize and solve the structure of the 2C H-2Ld-QL9 complex at 2.35 A resolution The protein H2-L had additional mutation F9Y (possibly UniProtKB entry residue F8) which increased solubility of the protein. tcr-mhc-2 2 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain V T certain certain sequence position certain certain certain sequence position certain I T Wed May 02 17:35:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val36thr,ile47thr' Tue Jun 30 16:55:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val36Thr;Ile47Thr]' ecoli Escherichia coli (strain K12) physical association physical association figure 5B. The protein H2-L had additional mutation F9Y which increased solubility of the proteins. These residue position however do not correspond to the UniProtKB entry. The Cytotoxic Tcell receptor precursor described here has mutation in the linker V beta 8.2 region to increase solubility. The mutations described are gly17glu his47tyr iso75thr leu81ser TCR with the gly17glu his47tyr iso75thr leu81ser mutations shows a Kd of 0.029 micromoles.