MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The morphology proteins Mdm12/Mmm1 function in the major beta-barrel assembly pathway of mitochondria. The morphology proteins Mdm12/Mmm1 function in the major beta-barrel assembly pathway of mitochondria. EMBO J. (0261-4189) 2007 imex curation Meisinger C., Pfannschmidt S., Rissler M., Milenkovic D., Becker T., Stojanovski D., Youngman MJ., Jensen RE., Chacinska A., Guiard B., Pfanner N., Wiedemann N. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Meisinger C., Pfannschmidt S., Rissler M., Milenkovic D., Becker T., Stojanovski D., Youngman MJ., Jensen RE., Chacinska A., Guiard B., Pfanner N., Wiedemann N. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation mmm1_yeast Maintenance of mitochondrial morphology protein 1 MMM1 Yeast mitochondrial escape protein 6 Mitochondrial outer membrane protein MMM1 YME6 L1357 YLL006W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDSENESTETDSLMTFDDYISKELPEHLQRLIMENLKGSTTNDLKQTSNNSEFNVSKNGSFKGLDDAIQALQMQSVLHPSSLGSLATSSKFSGWSFAQGFFVGQLSIVLLFIFFLKFFIFSDEPSKSKNPKPAASRHRSKFKEYPFISREFLTSLVRKGAKQHYELNEEAENEHLQELALILEKTYYNVDVHPAESLDWFNVLVAQIIQQFRSEAWHRDNILHSLNDFIGRKSPDLPEYLDTIKITELDTGDDFPIFSNCRIQYSPNSGNKKLEAKIDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFASTSNGSSSENGMEGNSGYFLMFSFSPEYRMEFEIKSLIGSRSKLENIPKIGSVIEYQIKKWFVERCVEPRFQFVRLPSMWPRSKNTREEKPTEL 3610AEC2109355AF 3610AEC2109355AF mdm12_yeast Mitochondrial distribution and morphology protein 12 YOL009C MDM12 Mitochondrial inheritance component MDM12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEITDPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFLCDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE D4A89786CE59CAB4 D4A89786CE59CAB4 sam35_yeast Sorting assembly machinery 35 kDa subunit YHR083W SAM35 OMP85 TOB38 TOM38 TOB complex 38 kDa subunit Mitochondrial 38 kDa outer membrane protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSSFSVPMPVKRIFDTFPLQTYAAQTDKDEAVALEIQRRSYTFTERGGGSSELTVEGTYKLGVYNVFLEANTGAALATDPWCLFVQLALCQKNGLVLPTHSQEQTPSHTCNHEMLVLSRLSNPDEALPILVEGYKKRIIRSTVAISEIMRSRILDDAEQLMYYTLLDTVLYDCWITQIIFCASDAQFMELYSCQKLSGSIVTPLDVENSLLQKLSAKSLKISLTKRNKFQFRHREIVKSMQGVYHNHHNSVNQEQVLNVLFENSKQVLLGLKDMLKSDGQPTYLHLKIASYILCITNVKEPIKLKTFVENECKELVQFAQDTLKNFVQ 4DCA565B56F35E4D sam37_yeast Sorting assembly machinery 37 kDa subunit SAM37 MAS37 PET3027 TOM37 Mitochondrial 37 kDa outer membrane protein MAS37 protein YM9796.13C YMR060C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKGSVHLWGKDGKASLISVDSIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKLPVLILDNGTKVSGYVNIVQFLHKNICTSKYEKGTDYEEDLAIVRKKDRLLEYSLLNYVDVEISRLTDYQLFLNTKNYNEYTKKLFSKLLYFPMWYNTPLQLRSQARENCEEIIGSLTLEDDEEFVESKAMESASQLAQSKTFKIAHKNKIKGKQELQQVKYNLQFDNRLQSCVSNWLAARKKLDDSVILSSDLLFLANLYVQLGLPDGNRIRSKLEQTFGSELLNSMSNKIDDFVHRPSNNLEQRDPQFREQGNVVMSLYNLACKYI D4ABA929CE5CAD16 sam50_yeast Sorting assembly machinery 50 kDa subunit SAM50 YNL026W N2802 TOB55 TOB complex 55 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSSSGVDNEISLDSPMPIFNESSTLKPIRVAGVVTTGTDHIDPSVLQAYLDDTIMKSITLGQLVKNADVLNKRLCQHHIALNAKQSFHFQGNTYISDEKETHDVVPLMEVVSQLDILPPKTFTAKTGTNFGNDNDAEAYLQFEKLIDKKYLKLPTRVNLEILRGTKIHSSFLFNSYSSLSPQSILNLKVFSQFYNWNTNKGLDIGQRGARLSLRYEPLFLHKLLHNPHSNESPTLFHEWFLETCWRSTKICSQGTSAPYMYSGTMLSQAGDQLRTILGHTFVLDKRDHIMCPTKGSMLKWSNELSPGKHLKTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAFL 651A1FE08A1F1845 mdm10_yeast Mitochondrial distribution and morphology protein 10 MDM10 YAL010C FUN37 Mitochondrial inheritance component MDM10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPYMDQVLRAFYQSTHWSTQNSYEDITATSRTLLDFRIPSAIHLQISNKSTPNTFNSLDFSTRSRINGSLSYLYSDAQQLEKFMRNSTDIPLQDATETYRQLQPNLNFSVSSANTLSSDNTTVDNDKKLLHDSKFVKKSLYYGRMYYPSSDLEAMIIKRLSPQTQFMLKGVSSFKESLNVLTCYFQRDSHRNLQEWIFSTSDLLCGYRVLHNFLTTPSKFNTSLYNNSSLSLGAEFWLGLVSLSPGCSTTLRYYTHSTNTGRPLTLTLSWNPLFGHISSTYSAKTGTNSTFCAKYDFNLYSIESNLSFGCEFWQKKHHLLETNKNNNDKLEPISDELVDINPNSRATKLLHENVPDLNSAVNDIPSTLDIPVHKQKLLNDLTYAFSSSLRKIDEERSTIEKFDNKINSSIFTSVWKLSTSLRDKTLKLLWEGKWRGFLISAGTELVFTRGFQESLSDDEKNDNAISISATDTENGNIPVFPAKFGIQFQYST 5AE98366B5EF25E5 5AE98366B5EF25E5 mdm10-mdm12 1 MDM12 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SAM35 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MMM1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SAM37 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1A EMBO-Journal mint mdm12-mdm10 1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MMM1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1C EMBO-Journal mint mmm1-mdm10 1 MDM12 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F1B EMBO-Journal mint sam35-mdm10 1 SAM37 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SAM50 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F1D EMBO-Journal mint