IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. Plant J. (0960-7412) 2007 Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de 01-April-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de Accepted 2008-MAR-6 by CDEROW. 01-April-2008: Contacted by JYOTI. Plant J. (0960-7412) 2007 SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. Plant J. (0960-7412) 2007 Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de 01-April-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de Accepted 2008-MAR-6 by CDEROW. 01-April-2008: Contacted by JYOTI. Plant J. (0960-7412) 2007 SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. Plant J. (0960-7412) 2007 Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de 01-April-2008: Contacted by JYOTI. tobac-by_2 Tobacco cell line by_2 Tobacco cell line An undifferentiated cell line derived from tobacco callus tissue. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de Accepted 2008-MAR-6 by CDEROW. 01-April-2008: Contacted by JYOTI. Plant J. (0960-7412) 2007 SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. Plant J. (0960-7412) 2007 Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de 01-April-2008: Contacted by JYOTI. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de Accepted 2008-MAR-6 by CDEROW. 01-April-2008: Contacted by JYOTI. Plant J. (0960-7412) 2007 SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. SA-inducible Arabidopsis glutaredoxin interacts with TGA factors and suppresses JA-responsive PDF1.2 transcription. Plant J. (0960-7412) 2007 Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de 01-April-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ndamukong I., Abdallat AA., Thurow C., Fode B., Zander M., Weigel R., Gatz C. I think Sandra produced a list of what was and what was not to be considered 'direct interactions' which (of course) I cannot find - I'll ask her at the meeting - I am fine with 'physical interaction' . The N-terminus of the yellow fluorescent protein (YN) was fused in-frame to the TGA2 coding region. The YFP C-terminus (YC) was fused N-terminally to AT2G28480. The constructs were transiently expressed in Arabidopsis leaf mesophyll protoplasts.Reconstitution of a fluorescing YFP chromophore occurred only upon co-expression of both proteins. cgatz@gwdg.de Accepted 2008-MAR-6 by CDEROW. 01-April-2008: Contacted by JYOTI. Arabidopsis cDNA library Plant J. (0960-7412) 2007 grxc9_arath Glutaredoxin-C9 GRXC9 F3M18.8 At1g28480 GRX480 ROXY19 Protein ROXY 19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQGTISCARNYNMTTTVGESLRPLSLKTQGNGERVRMVVEENAVIVIGRRGCCMCHVVRRLLLGLGVNPAVLEIDEEREDEVLSELENIGVQGGGGTVKLPAVYVGGRLFGGLDRVMATHISGELVPILKEVGALWL 3009870CF31CE3DE tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE D3033153BCE932C4 npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR DIP protein P93002 original sequence version: 106 DDD618146254CD68 tga21_tobac TGACG-sequence-specific DNA-binding protein TGA-2.1 TGA21 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MASKIGTAGNRSGTTGMPSFISQIPVSNPMGTEANNTNTSRMSDFGVLEQYLGFRIGDGANVNRSPLFNSTSATNPAVGFEVSGTINRTLAPSNTSLPTATPRSQTMLLQSNLVSASGTHHENWGESNMADSGSRTDTSTDMDGDDKNQLIEAGQSSDKSKEKVLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNIADQSNGVGANGPLAFDAEYSRWLEEHNKHINELRTAVNAHASDPELRSIVNNVTAHFDEVFRVKGNAAKADVFHVLSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLAGIYNLQQSSHQAEDALSQGMEALQQSLAETLANGSPAPEGSSGDVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRVLTTRQSARALLAINEYFSRLRALSSLWLARPREQLV E4768228210B8167 q9sqk1_tobac TGA2.2 LOC107776910 LOC107827018 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MADISPSTSTDADTEDKNRFLNSQQLGAVASDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQSQSMSGNGALAFDVEYARWLEEQNRRINELRGAVNSHAGDGELRIIVDGILAHYDDIFRIKGDAAKSDVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAISDYFSRLRALSSLWLARPRE D4D07B76348F1895 tga6_arath Transcription factor TGA6 TGA6 BZIP45 At3g12250 F28J15.6 MQC3.8 bZIP transcription factor 45 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE 2A55F2F336648A48 tga10_tobac bZIP transcription factor TGA10 Protein TGACG (TGA) motif-binding protein 10 TGA10 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MGFERAFVESSPEQENKLFVGVSYMDSSNKNQDPSESNNQISFGGQHQHHQQQFFYNHHQQQQLQNNNQVSFGMMQQSSSAIPGSLISKDSAGAYDLGELDQALFQYLDGQEPSSIQEQRQNSGMRPPTLNIFPSQPMHVEPSTTNKMNTGLVSPAISGSKRSSQPSMELSNNLKNNDAPSASGPEPPKAAKREGNRKGPTSSSEQDAPKTPDPKTLRRLAQNREAARKSRLRKKAYVQQLESSRIRLTQLEQELQRARAQGYYFGGNSLLGGEQNLPVNLANMSSDAAVFDMEYARWLEEHHRLMCELRNAVQEHFPENELRIYVDNCVTHYDEIMNLKSMLTKSDVFHLVSGMWKTPAERCFMWMGGFRPSELLKIILSQIEPLTEQQLMGICGLQQSTQEAEDALSQGLEALNHSLSDTIASDALSCPQNMANYMGQMALAMNKLSTLEGFVRQADNLRHQTIHRLHQLLTTRQAARCFLAIAEYFHRLRALSSLWHARPRQE B99962F2CEA67870 tga1a_tobac TGACG-sequence-specific DNA-binding protein TGA-1A TGA1A TGA1 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MGICDPIHQLGMWDDFNSSFPSTSATMILEVDKCLEDQIPIMEKRLDNETEDTSHGTVGTSNRYEPETSKPVEKVLRRLAQNREAARKSRLRKKAYVQQLENSKLKLIQLEQELERARKQGMCVGGGVDASQLSYSGTASSGTAVFDMEYGHWVEEQTRQTNDLRIALHSQIGEAELRIIVDGYLNHYFDLFRMKATAAKADVLYIMSGMWKTSAERFFMWIGGFRPSELLKVLTPHLELLTEQQLREVCNLTQSCQQAEDALSQGMVKLHQILAEAVAAGRLGEGNYTLPQMGPAIEKLEDLVRFVNQADHLRQETLQQMSRILNTCQAAQGLLALGEYFERLRVLSSQWATRLREPT 167FC8DB03CAEA76 tga2_2-at1g28480 5 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association The authors assert that the bait protein was in the form of a dimer Histidine prototrophy was restored only in the presence of NtTGA2.2 (data not shown), indicating that the gene product of At1g28480 is recruited to the as-1 element only in the presence of NtTGA2.2. at1g28480-tga2_2 2 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2, Table 1 tga2_2-at1g28480-1 2 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No online paper unavailable - therefore no source text entered Table 1 tga2-at1g28480 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association No online paper unavailable - therefore no source text entered Table 1 tga6-at1g28480 2 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No online paper unavailable - therefore no source text entered Table 1 at1g28480-tga2_1 2 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 1 at1g28480-tga1a 2 6 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association No online paper unavailable - therefore no source text entered Table 1 at1g28480-tga10 2 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association No online paper unavailable - therefore no source text entered Table 1 tga2_2-npr1 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role ancillary ancillary physical association physical association Table 1 In this assay Atg28480 (bait) and NPR (prey) with or without the presence of At1g28480; positive results were only seen when TGA2.2 was present. It is therefore clear TGA2.2 acts as a bridge between Atg28480 and NPR1. Therefore, a yeast 'bridge assay' was carried out with BD-GRX480 and AD-NPR1 fusion proteins expressed together with NtTGA2.2. Growth under selective conditions occurred only when NtTGA2.2 was provided as a bridging component tga2-at1g28480-1 4 6 unspecified role unspecified role neutral component neutral component region C terminal region of the YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region N terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association GRX480 interacts with TGA2 in planta 1b tga2-at1g28480-2 3 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association In planta two hybrid system documenting the interaction between NtTGA2.2 and GRX480. Supplementary Figure S1