IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. Development (0950-1991) 2007 imex curation Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de 22-Jan-2008: Contacted by JYOTI. A cDNA library which was enriched for transcripts expressed in meristamatic tissue. Only protein-protein interactions allpo Allium porrum (Leek) bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de Accepted 2007-DEC-14 by JYOTI. 22-Jan-2008: Contacted by JYOTI. Development (0950-1991) 2007 Only protein-protein interactions imex curation The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. Development (0950-1991) 2007 imex curation Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de 22-Jan-2008: Contacted by JYOTI. A cDNA library which was enriched for transcripts expressed in meristamatic tissue. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de Accepted 2007-DEC-14 by JYOTI. A cDNA library which was enriched for transcripts expressed in meristamatic tissue. Development (0950-1991) 2007 Only protein-protein interactions imex curation The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA. Development (0950-1991) 2007 imex curation Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de 22-Jan-2008: Contacted by JYOTI. A cDNA library which was enriched for transcripts expressed in meristamatic tissue. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chandler JW., Cole M., Flier A., Grewe B., Werr W. The constructs were introduced into leek epidermal cells using partical bombardment. john.chandler@uni-koeln.de Accepted 2007-DEC-14 by JYOTI. 22-Jan-2008: Contacted by JYOTI. Development (0950-1991) 2007 Only protein-protein interactions imex curation atbh9_arath Homeobox-leucine zipper protein ATHB-9 ATHB-9 HB9 At1g30490 PHV Homeodomain transcription factor ATHB-9 HD-ZIP protein ATHB-9 Protein PHAVOLUTA F26G16.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMAHHSMDDRDSPDKGFDSGKYVRYTPEQVEALERVYAECPKPSSLRRQQLIRECPILCNIEPRQIKVWFQNRRCREKQRKESARLQTVNRKLSAMNKLLMEENDRLQKQVSNLVYENGFMKHRIHTASGTTTDNSCESVVVSGQQRQQQNPTHQHPQRDVNNPANLLSIAEETLAEFLCKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGIAARACGLVSLEPMKVAEILKDRPSWFRDCRCVETLNVIPTGNGGTIELVNTQIYAPTTLAAARDFWTLRYSTSLEDGSYVVCERSLTSATGGPNGPLSSSFVRAKMLSSGFLIRPCDGGGSIIHIVDHVDLDVSSVPEVLRPLYESSKILAQKMTVAALRHVRQIAQETSGEVQYSGGRQPAVLRTFSQRLCRGFNDAVNGFVDDGWSPMSSDGGEDITIMINSSSAKFAGSQYGSSFLPSFGSGVLCAKASMLLQNVPPLVLIRFLREHRAEWADYGVDAYSAASLRATPYAVPCVRTGGFPSNQVILPLAQTLEHEEFLEVVRLGGHAYSPEDMGLSRDMYLLQLCSGVDENVVGGCAQLVFAPIDESFADDAPLLPSGFRVIPLDQKTNPNDHQSASRTRDLASSLDGSTKTDSETNSRLVLTIAFQFTFDNHSRDNVATMARQYVRNVVGSIQRVALAITPRPGSMQLPTSPEALTLVRWITRSYSIHTGADLFGADSQSCGGDTLLKQLWDHSDAILCCSLKTNASPVFTFANQAGLDMLETTLVALQDIMLDKTLDDSGRRALCSEFAKIMQQGYANLPAGICVSSMGRPVSYEQATVWKVVDDNESNHCLAFTLVSWSFV E11FB264485F91CA esr1_arath Ethylene-responsive transcription factor ESR1 ESR1 DRN ERF089 F3F19.1 At1g12980 Protein ENHANCER OF SHOOT REGENERATION 1 Protein DORNROSCHEN protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKALRNFTESTHSPDPNPLTKFFTEPTASPVSRNRKLSSKDTTVTIAGAGSSTTRYRGVRRRPWGRYAAEIRDPMSKERRWLGTFDTAEQAACAYDSAARAFRGAKARTNFTYPTAVIMPEPRFSFSNKKSSPSARCPLPSLPLDSSTQNFYGAPAAQRIYNTQSIFLRDASCSSRKTTPYNNSFNGSSSSYSASKTACVSYSENENNESFFPEESSDTGLLQEVVQEFLKKNRGVPPSPPTPPPVTSHHDNSGYFSNLTIYSENMVQETKETLSSKLDRYGNFQANDDGVRAVADGGLSLGSNEWGYQEMLMYGTQLGCTCRRSWG 66320534B5FCAE6B esr2_arath Ethylene-responsive transcription factor ESR2 ESR2 DRNL ERF090 SOB2 F21J9.25 At1g24590 Protein ENHANCER OF SHOOT REGENERATION 2 Protein DORNROESCHEN-LIKE Protein SUPPRESSOR OF PHYTOCHROMEB 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEAIMRLEGAEHRETNIHSLKRKPSRTSSTAPGSPGGVTTAKAASGAGASGVSTIRYRGVRRRPWGRYAAEIRDPLSKERRWLGTFDTAEEAACAYDCAARAMRGLKARTNFVYPMPSLDSYHHRIFSSPPMNMFLLRDVLNSQSLSPLTTFAYPPCNLSNVNDVVHESFTNVNDVCEDLSPKAKRSSTIENESLISNIFEPEPASSGLLQEIVQGFLPKPISQHASIPPKSNQQSVGVFPTMPESGFQTDVRLADFHVEGNGFGQVKYHGELGWADHENGFDSAKMQQNGNGGMFYQYCFHDDY 4B77DFDDC4C4B59A drn-phv 2 4 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Of note was PHV (AtHB9; At1g30490), which was independently isolated eight times, based on cDNA termini sequences. All isolated PHV clones encoded C-terminal parts of the protein, extending maximally from amino acid 754 to the last amino acid, 841. phv-drn 3 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A 4D 4F Full-length PHV protein can precipitate fulllength DRN (A) or DRNL (B). phv-drl 3 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 3B 4D 4F Full-length PHV protein can precipitate fulllength DRN (A) or DRNL (B). phv-drl-1 1 4 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component c-terminal n-terminal region of the yfp protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3G in leek epidermal cells to verify the observed biochemical interaction between DRN or DRNL and PHV, in vivo, using fulllength DRN and PHVs as the C-terminal part of PHV was sufficient to sustain interaction with DRN in the two-hybrid screen. phv-drn-1 1 4 unspecified role unspecified role neutral component neutral component c-terminal c-terminal region of the yfp protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component c terminal n-terminal region of the yfp protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3F in leek epidermal cells to verify the observed biochemical interaction between DRN or DRNL and PHV, in vivo, using fulllength DRN and PHVs as the C-terminal part of PHV was sufficient to sustain interaction with DRN in the two-hybrid screen.