MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it RNA interference targeting alpha8 integrin attenuates smooth muscle cell growth. RNA interference targeting alpha8 integrin attenuates smooth muscle cell growth. FEBS Lett. (0014-5793) 2007 imex curation Zargham R., Wamhoff BR., Thibault G. zarghar@ircm.qc.ca 2009-01-08 Only protein-protein interactions rat-vsmc Rattus norvegicus vsmc Human aortic vascular smooth muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zargham R., Wamhoff BR., Thibault G. zarghar@ircm.qc.ca FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation q9wup8_rat protein protein rat Rattus norvegicus (Rat) Rat PELSAFLRNATIPHLVRKRDVPVVQPHRQSPARILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLKRKNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSFSIPLWVIMLAILLGLLVLAILTLALWKCGFFDRARPPQDD fragmentation type: fragment mint 2EB9BC78ED4480CA rhoa_rat Transforming protein RhoA Rhoa Arha Arha2 protein protein rat Rattus norvegicus (Rat) Rat MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL C4C8BDC31FF858BC itga8-rhoa 1 Integrin aplha 8 2 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RhoA 3 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F4A FEBS-Letters mint