MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. EMBO J. (0261-4189) 2007 imex curation Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. 2009-01-08 Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. EMBO J. (0261-4189) 2007 imex curation Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. Structure of GlnK1 with bound effectors indicates regulatory mechanism for ammonia uptake. EMBO J. (0261-4189) 2007 imex curation Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. 2009-01-08 Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yildiz O., Kalthoff C., Raunser S., Kühlbrandt W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation amt2_metja Ammonium transporter Amt2 amt2 MJ1343 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MWGENIATADLFANATDIHSIVQALTTLANASDVFFLVVMGVLVFMMQWGFAMLEGGQVRKKNVNNVMMKNMVDWLIGCVAWLFIGGILCSKGFDLSAFIDWWKQILGTNWPNNGLDLASWFFGLVFCATAATIVSGGVAERIKFSAYVLISLIITGLLYPLFVYLGPWGASIVPWHDYAGSLVVHGLGGFLALGAIAALGPRIGRFVDGRPVPILGHNIPMAVFGAFALAIGWYGFNVGSSLALGDISGLVCATTTMAMAGGGIGALIASRNDVLFTANGIVAGLVAICSGTDVVSPIGGLIIGLIAGLQVPIVYKLVEKAGLDDVCGVVPVHGTAGVIGAILTGILGLKIFGGAGGVSLIDQIIGAVFCIIYGTGLGYILAKIVGIALGGLRVSEEEEKMGLDMAEHKMPAYPEETVI mint F7AE2554D19DACA2 glnk1_metja Nitrogen regulatory protein GlnK1 glnK1 MJ0059 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREYIVDLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTKEEGKEAL mint 3DC3F307C32FE9F3 y059-y1343 3 Glnk1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Amt1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F1A EMBO-Journal mint y059-y059-1 2 Glnk1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Glnk1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F4 EMBO-Journal Glnk1 assumes a trimeric conformation. mint y059-y1343-1 1 Glnk1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Amt1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3 EMBO-Journal mint