MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. EMBO J. (0261-4189) 2007 imex curation Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. EMBO J. (0261-4189) 2007 imex curation Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. 2009-01-08 Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. EMBO J. (0261-4189) 2007 imex curation Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. 2009-01-08 Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies. EMBO J. (0261-4189) 2007 imex curation Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. 2009-01-08 Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zwilling D., Cypionka A., Pohl WH., Fasshauer D., Walla PJ., Wahl MC., Jahn R. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT DIP protein O75379 original sequence version: 118 DIP protein O75379 original sequence version: 128 DIP protein O75379 original sequence version: 133 556CC682D26CF91E stx12_human Syntaxin-12 STX12 protein protein human Homo sapiens Human MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK DIP protein Q86Y82 original sequence version: 119 2338061572ED7DA1 stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL DIP protein O43752 original sequence version: 117 DIP protein O43752 original sequence version: 129 DIP protein O43752 original sequence version: 134 CC05C025DE1FE89E vti1a_human Vesicle transport through interaction with t-SNAREs homolog 1A VTI1A Vesicle transport v-SNARE protein Vti1-like 2 Vti1-rp2 protein protein human Homo sapiens Human MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH DIP protein Q96AJ9 original sequence version: 92 DIP protein Q96AJ9 original sequence version: 108 3FE5FE787B5958F0 stx12-stx6 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052305: original sequence: 47-117 : GPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKI 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052313: original sequence: 169-232 : QDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSD syntaxin 13 182-250 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052317: original sequence: 182-250 : KERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRK 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052309: original sequence: 115-119 : GDDGNSSENQRAHLLDNTERLERS physical association physical association F2A EMBO-Journal homomint mint stx12-stx6-1 3 182-250 syntaxin 13 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052332: original sequence: 182-250 : KERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRK 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052346: original sequence: 47-117 : GPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKI 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052342: original sequence: 115-119 : GDDGNSSENQRAHLLDNTERLERS 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052338: original sequence: 169-232 : QDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSD association association SF2 EMBO-Journal homomint mint stx12-stx6-2 4 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052358: original sequence: 115-119 : GDDGNSSENQRAHLLDNTERLERS 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052362: original sequence: 169-232 : QDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSD 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052354: original sequence: 47-117 : GPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKI syntaxin 13 182-250 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052366: original sequence: 182-250 : KERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRK physical association physical association SF1 EMBO-Journal homomint mint stx12-stx6-3 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052300: original sequence: 47-117 : GPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKI 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052292: original sequence: 169-232 : QDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSD 182-250 syntaxin 13 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052288: original sequence: 182-250 : KERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRK 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4052296: original sequence: 115-119 : GDDGNSSENQRAHLLDNTERLERS physical association physical association F3 EMBO-Journal homomint mint