MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Tim21 binding domain connects the preprotein translocases of both mitochondrial membranes. The Tim21 binding domain connects the preprotein translocases of both mitochondrial membranes. EMBO Rep. (1469-221X) 2006 imex curation Albrecht R., Rehling P., Chacinska A., Brix J., Cadamuro SA., Volkmer R., Guiard B., Pfanner N., Zeth K. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Albrecht R., Rehling P., Chacinska A., Brix J., Cadamuro SA., Volkmer R., Guiard B., Pfanner N., Zeth K. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation The Tim21 binding domain connects the preprotein translocases of both mitochondrial membranes. The Tim21 binding domain connects the preprotein translocases of both mitochondrial membranes. EMBO Rep. (1469-221X) 2006 imex curation Albrecht R., Rehling P., Chacinska A., Brix J., Cadamuro SA., Volkmer R., Guiard B., Pfanner N., Zeth K. 2009-01-08 Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Albrecht R., Rehling P., Chacinska A., Brix J., Cadamuro SA., Volkmer R., Guiard B., Pfanner N., Zeth K. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation tim22_yeast Mitochondrial import inner membrane translocase subunit TIM22 D0884 YDL217C TIM22 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFKE 3C94DBF31F413968 3C94DBF31F413968 tim21_yeast Mitochondrial import inner membrane translocase subunit TIM21 TIM21 YGR033C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSLPRSLLRLGHRKPLFPRYNTFVNSSVITHTSLLRTRLYSNGTGATSGKKDDKTRNKPKPLWPQVKSASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD FC140F3034E5B5BB FC140F3034E5B5BB tim21-tim22 1 TIM22 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TIM21 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4055144: original sequence: 103-237 : SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGP direct interaction direct interaction F1A EMBO-Reports mint tim21-tim22-1 2 TIM21 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4055164: original sequence: 103-237 : SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGP TIM22 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1B EMBO-Reports mint