IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer rsamant@usouthal.edu 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis rsamant@usouthal.edu Accepted 2007-FEB-15 by ORCHARD. 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. Biochem. Biophys. Res. Commun. (0006-291X) 2006 orchard Only protein-protein interactions imex curation Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer rsamant@usouthal.edu 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis rsamant@usouthal.edu Accepted 2007-FEB-15 by ORCHARD. 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. Biochem. Biophys. Res. Commun. (0006-291X) 2006 orchard Only protein-protein interactions imex curation Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer rsamant@usouthal.edu 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis rsamant@usouthal.edu Accepted 2007-FEB-15 by ORCHARD. 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. Biochem. Biophys. Res. Commun. (0006-291X) 2006 orchard Only protein-protein interactions imex curation Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer rsamant@usouthal.edu 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. orchard Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma pull down pull down ms participant Identification by mass spectrometry ms participant Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Whole cell lysate from MDA-MB-231-BRMS1 was partially purified with anti-BRMS1 antibody linked to an agarose matrix, followed by SDS-PAGE of the fractions of the eluate containing BRMS1 and potential interactors, and Coomassie staining. Visible bands were excised, trypsin digested and identified by MALDI-TOF-MS. rsamant@usouthal.edu Accepted 2007-FEB-15 by ORCHARD. 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. Biochem. Biophys. Res. Commun. (0006-291X) 2006 orchard Only protein-protein interactions imex curation Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer rsamant@usouthal.edu 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hurst DR., Mehta A., Moore BP., Phadke PA., Meehan WJ., Accavitti MA., Shevde LA., Hopper JE., Xie Y., Welch DR., Samant RS. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-IP experiments in fig 2B could not be curated as the antibody for Hsp90 is not specific for just form of the protein. rsamant@usouthal.edu Accepted 2007-FEB-15 by ORCHARD. 02-MAR-2006: Contacted by JYOTI. Human mammary gland, prostate and placenta cDNA libraries were used. Biochem. Biophys. Res. Commun. (0006-291X) 2006 orchard Only protein-protein interactions imex curation smtn_human Smoothelin SMTN SMSMO protein protein human Homo sapiens Human MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQDNKENWLHSQQREAEQRAALARLAGQLESMNDVEELTALLRSAGEYEERKLIRAAIRRVRAQEIEAATLAGRLYSGRPNSGSREDSKGLAAHRLEQCEVPEREEQEQQAEVSKPTPTPEGTSQDVTTVTLLLRAPPGSTSSSPASPSSSPTPASPEPPLEPAEAQCLTAEVPGSPEPPPSPPKTTSPEPQESPTLPSTEGQVVNKLLSGPKETPAAQSPTRGPSDTKRADVAGPRPCQRSLSVLSPRQPAQNRESTPLASGPSSFQRAGSVRDRVHKFTSDSPMAARLQDGTPQAALSPLTPARLLGPSLTSTTPASSSSGSSSRGPSDTSSRFSKEQRGVAQPLAQLRSCPQEEGPRGRGLAARPLENRAGGPVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGTLARLGSVTHVTSFSHAPPSSRGGCSIKMEAEPAEPLAAAVEAANGAEQTRVNKAPEGRSPLSAEELMTIEDEGVLDKMLDQSTDFEERKLIRAALRELRQRKRDQRDKERERRLQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLVHSNDGTRTARTTTVESSFVRRSENGSGSTMMQTKTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV EC508A8239AA6B36 taf1_human Transcription initiation factor TFIID subunit 1 TAF1 BA2R CCG1 TAF2A CCGS Transcription initiation factor TFIID 250 kDa subunit TBP-associated factor 250 kDa Cell cycle gene 1 protein protein protein human Homo sapiens Human MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE DIP protein P21675 original sequence version: 92 DIP protein P21675 original sequence version: 149 DIP protein P21675 original sequence version: 172 93BE3D181A72ABEB hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 dnjb6_human DnaJ homolog subfamily B member 6 Heat shock protein J2 MSJ-1 HHDJ1 DNAJB6 HSJ2 MSJ1 MRJ protein protein human Homo sapiens Human MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGVADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLKEGGKRKKQKQREESKKKKSTKGNH ECF1628BF7A524F3 smce1_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 BRG1-associated factor 57 SMARCE1 BAF57 protein protein human Homo sapiens Human MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE DIP protein Q969G3 original sequence version: 86 DIP protein Q969G3 original sequence version: 78 DIP protein Q969G3 original sequence version: 97 6F1C1B7917BAD506 hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD hdac6_human Histone deacetylase 6 HDAC6 KIAA0901 JM21 Tubulin-lysine deacetylase HDAC6 protein protein human Homo sapiens Human MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH 6F17731268A33114 sds3_human Sin3 histone deacetylase corepressor complex component SDS3 Suppressor of defective silencing 3 protein homolog 45 kDa Sin3-associated polypeptide SUDS3 SAP45 SDS3 protein protein human Homo sapiens Human MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA 10A7393B607117EB nmi_human N-myc-interactor NMI N-myc and STAT interactor protein protein human Homo sapiens Human MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE EC228BD0C9E643F1 hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 hdac5_human Histone deacetylase 5 Antigen NY-CO-9 HDAC5 KIAA0600 protein protein human Homo sapiens Human MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL DIP protein Q9UQL6 original sequence version: 158 DIP protein Q9UQL6 original sequence version: 92 CF4BE774E3588FEC brms1_human Breast cancer metastasis-suppressor 1 BRMS1 protein protein human Homo sapiens Human MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP 89FB59FB96ECD4DB ari4a_human AT-rich interactive domain-containing protein 4A ARID4A RBBP1 RBP1 Retinoblastoma-binding protein 1 protein protein human Homo sapiens Human MKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQLVQDDQVKGPLRVGAIVETRTSDGSFQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLDQLPLTNPEHFGTPVIAKKTNRGRRSSLPVTEDEKEEESSEEEDEDKRRLNDELLGKVVSVVSATERTEWYPALVISPSCNDDITVKKDQCLVRSFIDSKFYSIARKDIKEVDILNLPESELSTKPGLQKASIFLKTRVVPDNWKMDISEILESSSSDDEDGPAEENDEEKEKEAKKTEEEVPEEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYHQGGCDNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTVHHHEPKVKEEKKDLEESMEEALKLDQEMPLTEVKSEPEENIDSNSESEREEIELKSPRGRRRIARDVNSIKKEIEEEKTEDKLKDNDTENKDVDDDYETAEKKENELLLGRKNTPKQKEKKIKKQEDSDKDSDEEEEKSQEREETESKCDSEGEEDEEDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGGPKKKQKKKAKNKEDSEKDEKRDEERQKSKRGRPPLKSTLSSNMPYGLSKTANSEGKSDSCSSDSETEDALEKNLINEELSLKDELEKNENLNDDKLDEENPKISAHILKENDRTQMQPLETLKLEVGENEQIVQIFGNKMEKTEEVKKEAEKSPKGKGRRSKTKDLSLEIIKISSFGQNEAGSEPHIEAHSLELSSLDNKNFSSATEDEIDQCVKEKKLKRKILGQSSPEKKIRIENGMEMTNTVSQERTSDCIGSEGMKNLNFEQHFERENEGMPSLIAESNQCIQQLTSERFDSPAEETVNIPLKEDEDAMPLIGPETLVCHEVDLDDLDEKDKTSIEDVAVESSESNSLVSIPPALPPVVQHNFSVASPLTLSQDESRSVKSESDITIEVDSIAEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTYKWSFQLNELDNMNSTERISFLQEKLQEIRKYYMSLKSEVATIDRRRKRLKKKDREVSHAGASMSSASSDTGMSPSSSSPPQNVLAVECR 5B3F6A5AFB7588CF ima6_human Importin subunit alpha-6 Karyopherin subunit alpha-5 KPNA5 protein protein human Homo sapiens Human MASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL DIP protein O15131 original sequence version: 94 757D4C56D0E5661F hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 9AA27B210730670C hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL DIP protein P56524 original sequence version: 158 DIP protein P56524 original sequence version: 149 DIP protein P56524 original sequence version: 151 BB7FD37652D12398 brms1-arid4a 1 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association The UniProtKb sequence differs from the sequence referenced by the authors (NM_002892) at positions 385 (L instead of V), 618 (S instead of R), and 779 (A instead of T). Table 1 Full-length BRMS1 was used as bait and human mammary gland (or prostate or placenta) cDNA library as prey. Six genetic interactors of BRMS1 were identified in addition to the previously reported mSDS3 (SAP45, suppressor of defective silencing, Sin3 associated protein) and RBBP1 (Rbbinding protein) brms1-sds3 1 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Table 1 Full-length BRMS1 was used as bait and human mammary gland (or prostate or placenta) cDNA library as prey. Six genetic interactors of BRMS1 were identified in addition to the previously reported mSDS3 (SAP45, suppressor of defective silencing, Sin3 associated protein) and RBBP1 (Rbbinding protein) brms1-smarce1 1 17 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) brms1-taf1 1 17 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) NM_004606, the prey sequence referenced by the authors, has an insertion (VSENGEGIILPSIIAPSSLAS) at aa 178-198, in between aa 178 and 177 of UniProtKb sequence P21675. brms1-nmi 1 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) The UniProtKb sequence Q13287 has an S instead of F at position 184, as compared to the prey sequence referenced by the authors (NM_004688). brms1-dnajb6 1 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) UniProtKb sequence O75190 has an insertion (aa 232-239) between 231 and 232 of the prey sequence (NM_005494) referenced by the authors. O75190 also has at positions 240 E not K, 242 R not Q, 243 M not L, 244 R not L, 246 G not L, 247 Q not D, 249 A not K, as compared to the corresponding positions in the NM_005494 sequence. brms1-p53814 1 6 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) brms1-kpna5 1 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Table 1 The six novel interactors are not part of the mSin3 core complex and include NMI (N-myc interactor), MRJ (Hsp40-related chaperone) [27], CCG1 (TAFII250, a protein essential for progression of G phase), SMTN (Smoothelin, a cytoskeletal protein specific to smooth muscles) [28], KPNA5 (karyopherin a 5) [29], and BAF 57 (BRG1 associated factor) NM_002269, the prey sequence referenced by the authors, has MDA at the N-terminus that the UniProtKb sequence O15131 does not have. O15131 has at position 67 S not P and at position 79 G not E, as compared to the corresponding positions in the NM_002269 sequence. brms1-hspa8 4 17 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association 1 immuno-affinity chromatography identified two other chaperone proteins known to form a complex with Hsp40; Hsp90 and Hsp70 sds3-brms1 5 13 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 2 A BRMS1 was co-immunoprecipitated with mSDS3, NMI, MRJ, and BAF57 from whole cell lysates (1 mg) of COS7 transient co-transfections. Q9HCU9; Q9H7L9 transfection dnajb6-brms1 5 9 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 2 A BRMS1 was co-immunoprecipitated with mSDS3, NMI, MRJ, and BAF57 from whole cell lysates (1 mg) of COS7 transient co-transfections. Q9HCU9; O75190 transfection nmi-brms1 5 14 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 2 A BRMS1 was co-immunoprecipitated with mSDS3, NMI, MRJ, and BAF57 from whole cell lysates (1 mg) of COS7 transient co-transfections. Q9HCU9; Q13287 transfection smarce1-brms1 5 10 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 2 A BRMS1 was co-immunoprecipitated with mSDS3, NMI, MRJ, and BAF57 from whole cell lysates (1 mg) of COS7 transient co-transfections. Q9HCU9; Q969G3 transfection brms1-hdac1 3 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q13547 transfection brms1-hdac2 3 17 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q92769 transfection brms1-hdac4 3 17 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; P56524 transfection brms1-hdac5 3 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q9UQL6 transfection brms1-hdac6 3 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q9UBN7 transfection hdac1-brms1 2 17 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q13547 transfection hdac2-brms1 2 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q92769 transfection hdac3-brms1 2 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; O15379 transfection The reciprocal coimmunoprecipitation was not shown. hdac4-brms1 2 22 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; P56524 transfection hdac5-brms1 2 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q9UQL6 transfection hdac6-brms1 2 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey physical association physical association 5 A BRMS1 and FLAG-epitope tagged HDAC-cDNAs were co-transfected in COS7. The immunoprecipitations by anti- FLAG antibodies showed BRMS1 co-immunoprecipitation (Fig. 5A). The reverse co-immunoprecipitation further confirmed these interactions Q9HCU9; Q9UBN7 transfection