IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Mol. Cell (1097-2765) 2006 imex curation Yang M., Gocke CB., Luo X., Borek D., Tomchick DR., Machius M., Otwinowski Z., Yu H. Chromatin - Epigenetic interactions resulting in chromatin modulation hongtao.yu@utsouthwestern.edu 07-Aug-2007: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yang M., Gocke CB., Luo X., Borek D., Tomchick DR., Machius M., Otwinowski Z., Yu H. Chromatin - Epigenetic interactions resulting in chromatin modulation hongtao.yu@utsouthwestern.edu Accepted 2007-AUG-17 by DAVET. 07-Aug-2007: Contacted by JYOTI. Mol. Cell (1097-2765) 2006 davet Only protein-protein interactions imex curation Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Mol. Cell (1097-2765) 2006 imex curation Yang M., Gocke CB., Luo X., Borek D., Tomchick DR., Machius M., Otwinowski Z., Yu H. Chromatin - Epigenetic interactions resulting in chromatin modulation hongtao.yu@utsouthwestern.edu 07-Aug-2007: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang M., Gocke CB., Luo X., Borek D., Tomchick DR., Machius M., Otwinowski Z., Yu H. Chromatin - Epigenetic interactions resulting in chromatin modulation hongtao.yu@utsouthwestern.edu Accepted 2007-AUG-17 by DAVET. Mol. Cell (1097-2765) 2006 davet Only protein-protein interactions imex curation kdm1a_human Lysine-specific histone demethylase 1A Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 KDM1A KIAA0601 LSD1 AOF2 KDM1 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM A61CEDE51E4E0C1D fad FAD - Flavin adenine dinucleotide Adenosine 5'-(trihydrogen pyrophosphate), 5'-5'-ester with riboflavine adenosine 5'-[3-(riboflavin-5'-yl) dihydrogen diphosphate] FAD Flavin adenine dinucleotide FLAVIN-ADENINE DINUCLEOTIDE Riboflavin 5'-(trihydrogen diphosphate), 5'-5'-ester with adenosine Riboflavin 5'-adenosine diphosphate adenosine 5'-(3-{D-ribo-5-[7,8-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl} dihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) Flavin adenine dinucleotide Flavin adenine dinucleotide 18bp oligonucleotide 18 bp duplex DNA oligonucleotide (5-ATCAATATCCACCTGCAG-3) ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) ATCAATATCCACCTGCAG 7241D69C24FAEBEA rcor1_human REST corepressor 1 RCOR1 KIAA0071 RCOR Protein CoREST protein protein human Homo sapiens Human MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS DIP protein Q9UKL0 original sequence version: 132 DIP protein Q9UKL0 original sequence version: 126 DIP protein Q9UKL0 original sequence version: 115 DIP protein Q9UKL0 original sequence version: 91 DIP protein Q9UKL0 original sequence version: 144 DIP protein Q9UKL0 original sequence version: 80 77E90FB0EFD514B2 lsd1-rcor1 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2.57 A Table 1 and Figure 1 The crystal structure of LSD1-CoREST was determined by single-wavelength anomalous dispersion and molecular replacement 18mer-rcor1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKL0:p.Lys421Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Mon Feb 27 13:55:10 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'lys418glu' Wed May 02 15:57:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys421glu' Tue Jun 30 15:58:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys421Glu' Q9UKL0:p.Asn422Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N D Mon Feb 27 13:54:04 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'asn419asp' Wed May 02 20:17:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn422asp' Tue Jun 30 18:56:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn422Asp' Q9UKL0:p.Arg429Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Mon Feb 27 13:52:40 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'arg426glu' Wed May 02 17:07:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg429glu' Tue Jun 30 18:04:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg429Glu' Q9UKL0:p.[Arg429Ala;Arg430Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Mon Feb 27 13:59:19 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'arg426ala,arg427ala' Wed May 02 18:55:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg429ala,arg430ala' Tue Jun 30 17:53:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg429Ala;Arg430Ala]' ecoli Escherichia coli (strain K12) physical association physical association Figure 5, S4 Chemical shift changes of four CoREST SANT2 residues are plotted against the molar ratio of DNA/SANT2. Kd of SANT2 DNA and the standard deviation are indicated.