IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. Plant Cell (1040-4651) 2006 Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de 22-Jan-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de Accepted 2007-DEC-14 by JYOTI. Plant Cell (1040-4651) 2006 Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. Plant Cell (1040-4651) 2006 Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de 22-Jan-2008: Contacted by JYOTI. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de Accepted 2007-DEC-14 by JYOTI. 22-Jan-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2006 pdx13_arath Pyridoxal 5'-phosphate synthase subunit PDX1.3 PDX13 GIP2 PDX1L3 RSR4 T10O8.120 At5g01410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINLNDEKVERFANRSE E74EBBCD4F124456 pdx11_arath Pyridoxal 5'-phosphate synthase subunit PDX1.1 HEVER-like protein PDX11 PDX1L1 F16M14.16 At2g38230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGTGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNVVEAVRHVRSVNGAIRLLRSMDDDEVFTYAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNLDDKVERFASRSE 10D9EEDAEDC0BC4C pdx12_arath Pyridoxal 5'-phosphate synthase-like subunit PDX1.2 PDX12 A37 PDX1L2 MSL1.3 At3g16050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQAMTDQDQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKLAESAGACSVIVSDPVRSRGGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISVADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLMGEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLGCDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNVRGDRIQDFGQGSV D894BC393CBBBA6A pdx2_arath Probable pyridoxal 5'-phosphate synthase subunit PDX2 PDX2 EMB2407 Protein EMBRYO DEFECTIVE 2407 Pyridoxal 5'-phosphate synthase glutaminase subunit muf9.190 At5g60540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLFPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEADILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEEDALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKEIEQGASSSSSKTIVSVGETSAGPEPAKPDLPIFQ 2B6447833990A677 pdx1_3-pdx1_1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 17:36:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54ser' Tue Jun 30 16:48:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Ser' physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx1_3-pdx1_2 1 3 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 20:33:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54ser' Tue Jun 30 16:54:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Ser' 5 unspecified role unspecified role prey prey physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx1_3-pdx1_3 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 14:41:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54ser' Tue Jun 30 19:11:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Ser' physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx1_3-pdx2 1 3 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 16:42:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54ser' Tue Jun 30 16:36:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Ser' 6 unspecified role unspecified role prey prey physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx2-pdx1_1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx2-pdx1_3 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 5B No online version of this paper was available; therefore source text annotations are not entered. pdx1_3-pdx1_2-1 2 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 16:44:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly54ser' Tue Jun 30 17:03:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly54Ser' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C No online version of this paper was available; therefore source text annotations are not entered. pdx1_1-pdx1_2-2 2 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C No online version of this paper was available; therefore source text annotations are not entered. pdx1_2-pdx1_2 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C No online version of this paper was available; therefore source text annotations are not entered.