IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Arabidopsis thaliana MND1 homologue plays a key role in meiotic homologous pairing, synapsis and recombination. The Arabidopsis thaliana MND1 homologue plays a key role in meiotic homologous pairing, synapsis and recombination. J. Cell. Sci. (0021-9533) 2006 imex curation Kerzendorfer C., Vignard J., Pedrosa-Harand A., Siwiec T., Akimcheva S., Jolivet S., Sablowski R., Armstrong S., Schweizer D., Mercier R., Schlogelhofer P. peter.schloegelhofer@univie.ac.at 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kerzendorfer C., Vignard J., Pedrosa-Harand A., Siwiec T., Akimcheva S., Jolivet S., Sablowski R., Armstrong S., Schweizer D., Mercier R., Schlogelhofer P. peter.schloegelhofer@univie.ac.at peter.schloegelhofer@univie.ac.at Accepted 2007-DEC-21 by JYOTI. J. Cell. Sci. (0021-9533) 2006 Only protein-protein interactions imex curation hop2_arath Homologous-pairing protein 2 homolog HOP2 T6J4.9 At1g13330 AHP2 Protein HOP2 Protein ARABIDOPSIS HOMOLOG PAIRING 2 Protein AHP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPKSDNTEAIVLNFVNEQNKPLNTQNAADALQKFNLKKTAVQKALDSLADAGKITFKEYGKQKIYIARQDQFEIPNSEELAQMKEDNAKLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLREGITLVRPEDKKAVEDMYADKINQWRKRKRMFRDIWDTVTENSPKDVKELKEELGIEYDEDVGLSFQAYADLIQHGKKRPRGQ 4F8FB9166ABF294B mnd1_arath Meiotic nuclear division protein 1 homolog MND1 Meiotic nuclear division 1-like protein F19B15.200 At4g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA 131BB5146D8C91ED ahp2-mnd1-1 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 9 Whereas all plasmid combinations enabled yeast strain AH109 to grow on synthetic dropout (SD) medium selecting for the presence of the plasmids (SD �Leu/�Trp), only simultaneous transformation of plasmids encoding AtMND1 and AHP2 fusion proteins led to growth on selective plates (SD �Leu/�Trp/�His). We therefore conclude that AtMND1 interacts with AHP2. mnd1-ahp2-1 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 9 Whereas all plasmid combinations enabled yeast strain AH109 to grow on synthetic dropout (SD) medium selecting for the presence of the plasmids (SD �Leu/�Trp), only simultaneous transformation of plasmids encoding AtMND1 and AHP2 fusion proteins led to growth on selective plates (SD �Leu/�Trp/�His). We therefore conclude that AtMND1 interacts with AHP2.