IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. Biotechnol. Lett. (0141-5492) 2006 Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. orchard in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be Accepted 2007-MAY-18 by ORCHARD. 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. Biotechnol. Lett. (0141-5492) 2006 orchard The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. Biotechnol. Lett. (0141-5492) 2006 Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be Accepted 2007-MAY-18 by ORCHARD. 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. Biotechnol. Lett. (0141-5492) 2006 orchard The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. Biotechnol. Lett. (0141-5492) 2006 Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be Accepted 2007-MAY-18 by ORCHARD. 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. Biotechnol. Lett. (0141-5492) 2006 orchard The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. Biotechnol. Lett. (0141-5492) 2006 Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. orchard human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy predetermined predetermined participant predetermined Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be Accepted 2007-MAY-18 by ORCHARD. 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. Biotechnol. Lett. (0141-5492) 2006 orchard The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton. Biotechnol. Lett. (0141-5492) 2006 Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. orchard human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dechamps C., Bach S., Portetelle D., Vandenbol M. Cancer - Interactions investigated in the context of cancer vandenbol.m@fsagx.ac.be Accepted 2007-MAY-18 by ORCHARD. 26-APR-2007: Contacted by JYOTI. A human skeletal muscle BD Matchmaker cDNA library (BD Biosciences Clontech) was used. Biotechnol. Lett. (0141-5492) 2006 orchard mlrv_human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform MYL2 Cardiac myosin light chain 2 MLC2 Myosin light chain 2, slow skeletal/ventricular muscle isoform Ventricular myosin light chain 2 protein protein human Homo sapiens Human MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD EA0BEF886AA3FAF5 p35125-3 Ubiquitin carboxyl-terminal hydrolase 6 210(ORF1) oncTre210p USP6 HRP1 TRE2 Deubiquitinating enzyme 6 Proto-oncogene TRE-2 Ubiquitin-specific-processing protease 6 Ubiquitin thioesterase 6 protein protein human Homo sapiens Human MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEHIHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFLLYLPEEDAFWALVQLLASERHSLPGFHSPNGGTVQGLQDQQEHVVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPITSIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDSNIKISPLHHLQMECSP Was shown to be tumorigenic in transfected mice and seems not to act as GTPase activating protein. 6D5D93D2CE65D879 ubp6_human Ubiquitin carboxyl-terminal hydrolase 6 Ubiquitin-specific-processing protease 6 Deubiquitinating enzyme 6 Proto-oncogene TRE-2 USP6 TRE2 HRP1 Ubiquitin thioesterase 6 protein protein human Homo sapiens Human MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEHIHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFLLYLPEEDAFWALVQLLASERHSLPGFHSPNGGTVQGLQDQQEHVVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPITSIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDSNIKNFPQDNQKVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQKDGNSCAWCPQYRFCRGCKIDCGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESVEQSRRAQAEPINLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQFVNDQWIKSQKIVRFLRESFDPSAFLVPRDPALCQHKPLTPQGDELSKPRILAREVKKVDAQSSAGKEDMLLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQDHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSTDEDSESDYEKYSMLQ D3A6822CEB441DB3 anr44_human Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B ANKRD44 Ankyrin repeat domain-containing protein 44 protein protein human Homo sapiens Human MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGRTPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELLAKGACVLAVDENASRSNGPRSTPGTAVQKEE 3502EBBD0D093566 usp6-myl2 2 7 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association The Tre-GAP-binding proteins identified in this experiment are Myl2 (muscle library) and LOC91526 (placental library). usp6-ankrd44 3 8 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association The Tre-GAP-binding proteins identified in this experiment are Myl2 (muscle library) and LOC91526 (placental library). The authors specify the protein LOC91526 is 919 aa but the longest UniProtKB entry is 944 aa. myl2-usp6 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 2 C In these experiments, Tre-GAP was pulled down by GST-Myl2 and GST-LOC91526 but not by GST alone ankrd44-usp6 1 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 2 C In these experiments, Tre-GAP was pulled down by GST-Myl2 and GST-LOC91526 but not by GST alone usp6-myl2-1 5 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3 In cells co-synthesising epitope-tagged Tre-GAP and Myl2 or LOC91526, we detected the expected interactions by immunoblotting (Figure 3), thus confirming their occurrence in vivo. P10916; P35125-3 transfection ankrd44-usp6-1 5 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 In cells co-synthesising epitope-tagged Tre-GAP and Myl2 or LOC91526, we detected the expected interactions by immunoblotting (Figure 3), thus confirming their occurrence in vivo. Q8N8A2; P35125-3 transfection usp6-ankrd44-1 5 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 In cells co-synthesising epitope-tagged Tre-GAP and Myl2 or LOC91526, we detected the expected interactions by immunoblotting (Figure 3), thus confirming their occurrence in vivo. Q8N8A2; P35125-3 transfection myl2-usp6-2 5 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 In cells co-synthesising epitope-tagged Tre-GAP and Myl2 or LOC91526, we detected the expected interactions by immunoblotting (Figure 3), thus confirming their occurrence in vivo. P10916; P35125-3 transfection myl2-usp6-1 4 6 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 4 D In cells cosynthesising Tre-GAP and Myl2 or LOC91526, the cosynthesised proteins were found to colocalise to the cell membrane Tre-GAP expression appears to cause MYL2 to relocate to cell membrane, as in the absence of Tre-GAP MYL2 is distributed throughout the cell. P10916; P35125-3 transfection ankrd44-usp6-2 4 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4 E In cells cosynthesising Tre-GAP and Myl2 or LOC91526, the cosynthesised proteins were found to colocalise to the cell membrane Tre-GAP expression appears to cause LOC91526 to relocate to cell membrane, as in the absence of Tre-GAP LOC91526 is distributed throughout the cell. Q8N8A2; P35125-3 transfection