IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction network among Escherichia coli membrane proteins involved in cell division as revealed by bacterial two-hybrid analysis. Interaction network among Escherichia coli membrane proteins involved in cell division as revealed by bacterial two-hybrid analysis. J. Bacteriol. (0021-9193) 2005 Karimova G., Dautin N., Ladant D. The bacterial adenylate cyclase two-hybrid (BACTH) system works by interaction-mediated reconstruction of a cyclic AMP (cAMP) signaling cascade. Target membrane proteins are fused to two fragments (T25 and T18) of catalytic domain of Bordatella pertussis adenylate cyclase (AC) and coexpressed in E. coli cya (strain deficient in endogenous AC). Interaction of hybrid proteins in the membrane leads to functional complementation of T25 and T18 fragments causing cAMP synthesis which acitvates transcription of catabolic operons e.g., lactose operon and maltose regulon, allowing the bacteria to utilize lactose and maltose. karimova@pasteur.fr 26-APR-2007: Contacted by JYOTI. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Karimova G., Dautin N., Ladant D. The bacterial adenylate cyclase two-hybrid (BACTH) system works by interaction-mediated reconstruction of a cyclic AMP (cAMP) signaling cascade. Target membrane proteins are fused to two fragments (T25 and T18) of catalytic domain of Bordatella pertussis adenylate cyclase (AC) and coexpressed in E. coli cya (strain deficient in endogenous AC). Interaction of hybrid proteins in the membrane leads to functional complementation of T25 and T18 fragments causing cAMP synthesis which acitvates transcription of catabolic operons e.g., lactose operon and maltose regulon, allowing the bacteria to utilize lactose and maltose. karimova@pasteur.fr Accepted 2007-MAY-4 by DAVET. 26-APR-2007: Contacted by JYOTI. J. Bacteriol. (0021-9193) 2005 ftsi_ecoli Peptidoglycan D,D-transpeptidase FtsI ftsI pbpB b0084 Penicillin-binding protein 3 JW0082 Essential cell division protein FtsI Murein transpeptidase Peptidoglycan synthase FtsI protein protein ecoli Escherichia coli (strain K12) MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS DIP protein P0AD68 original sequence version: 84 This sequence has been withdrawn from Uniprot. C89A403D5980B2CD ymgf_ecoli Inner membrane protein YmgF ymgF b4520 JW1156 protein protein ecoli Escherichia coli (strain K12) MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNRLRERLVNHRDQQ A94BA7114B05A553 ftsb_ecoli Cell division protein FtsB ftsB b2748 JW2718 ygbQ protein protein ecoli Escherichia coli (strain K12) MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR 9B50A7EF637809D7 ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsq_ecoli Cell division protein FtsQ ftsQ b0093 JW0091 protein protein ecoli Escherichia coli (strain K12) MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ 839A3D34B948CEAB ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 ftsl_ecoli Cell division protein FtsL ftsL mraR b0083 JW0081 yabD protein protein ecoli Escherichia coli (strain K12) MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQK 6DD5DF7B2ECB7090 ftsx_ecoli Cell division protein FtsX ftsX ftsS b3462 JW3427 protein protein ecoli Escherichia coli (strain K12) MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE DIP protein P0AC30 original sequence version: 60 C006ED56043739AE ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 ftsw_ecoli Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Lipid II flippase FtsW Peptidoglycan polymerase JW0087 b0089 protein protein ecoli Escherichia coli (strain K12) MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPMEFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDYETRLEKAQAFVRGSR DIP protein P0ABG4 original sequence version: 39 7935EC952AD9A1F3 ftsa-ftsa 1 5 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 the dimerization of only FtsA and FtsAFtsZ association has been experimentally documented by several independent approaches (protein overlay and yeast and bacterial two-hybrid systems). These interactions were clearly confirmed by the BACTH system ftsa-ftsi 1 5 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsA was also found to interact with several of the Fts membraneassociated proteins, in particular FtsI, FtsN, and FtsQ. ftsa-ftsn 1 5 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsA was also found to interact with several of the Fts membraneassociated proteins, in particular FtsI, FtsN, and FtsQ. ftsa-ftsq 1 6 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 FtsA was also found to interact with several of the Fts membraneassociated proteins, in particular FtsI, FtsN, and FtsQ. FtsQ19-276 and FtsQ1-266 displayed reduced binding to FtsA as compared to the wild-type protein. ftsi-ftsn 1 2 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 Our present BACTH data indicate that FtsN can indeed associate with FtsQ and FtsI ftsn-ftsq 1 6 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 Our present BACTH data indicate that FtsN can indeed associate with FtsQ and FtsI ftsn-ftsn 1 7 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 The BACTH analysis also showed that, in addition to FtsA, two other Fts proteins, FtsN and FtsQ, were able to dimerize or multimerize ftsa-ftsq-1 1 5 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 Interactions of FtsQ with FtsA and FtsI were clearly confirmed here by BACTH assays ftsi-ftsq 1 2 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 4 Interactions of FtsQ with FtsA and FtsI were clearly confirmed here by BACTH assays FtsI1-70, missing most of the periplasmic part of the protein, interacted with FtsQ as efficiently as full-length FtsI.FtsI19-52 interacted with FtsQ with reduced efficiency compared to FtsI1-70 but did not interact with FtsL, FtsW and YmgF. FtsI19-51 encompasses the transmembrane domain and 10 aa (42-51) of the periplasmic part of FtsI. ftsl-ftsq 1 8 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 our results indicate that FtsQ could associate with nearly all the tested Fts proteins, although with quite different efficiencies. ftsn-ftsq-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 our results indicate that FtsQ could associate with nearly all the tested Fts proteins, although with quite different efficiencies. ftsq-ftsq 1 6 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 The BACTH analysis also showed that, in addition to FtsA, two other Fts proteins, FtsN and FtsQ, were able to dimerize or multimerize FtsQ1-266 displayed reduced dimerization as compared to the wild-type FtsQ. ftsq-ftsx 1 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 our results indicate that FtsQ could associate with nearly all the tested Fts proteins ftsq-ymgf 1 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 YmgF was able to associate with three other Fts proteins: FtsI, FtsN, and FtsQ. ftsq-ftsx-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 The integral membrane protein FtsX was found to associate specifically with FtsA and FtsQ, thus suggesting that FtsX may contribute to the cytokinetic process. FtsQ19-276 and FtsQ1-266 showed reduced binding to FtsX as compared to wild-type FtsQ. ftsa-ftsx 1 5 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 The integral membrane protein FtsX was found to associate specifically with FtsA and FtsQ, thus suggesting that FtsX may contribute to the cytokinetic process. ftsa-ftsl 1 8 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers ftsi-ftsn-1 1 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 ftsi-ymgf 1 3 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 ftsi-ftsw 1 2 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 4 the FtsW binding site encompasses an extended transmembrane region of FtsI (aa 1 to 70) FtsI1-70, missing most of the periplasmic part of the protein, interacted with FtsW as efficiently as full-length FtsI. ftsl-ftsw 1 11 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsn-ftsw 1 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 ftsi-ymgf-1 1 2 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 4 YmgF was able to associate with three other Fts proteins: FtsI, FtsN, and FtsQ. FtsI1-70 displayed reduced interaction with YmgF as compared with full length FtsI. ftsn-ymgf 1 3 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 YmgF was able to associate with three other Fts proteins: FtsI, FtsN, and FtsQ. ftsq-ymgf-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 YmgF was able to associate with three other Fts proteins: FtsI, FtsN, and FtsQ. FtsQ1-246 interacted efficiently with YmgF, although it did not with any of the tested Fts proteins. ftsa-ftsz 1 5 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component c-terminal T25 fragment of B. pertussis adenylate cyclase tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2 Among all the tested proteins, the dimerization of only FtsA and FtsAFtsZ association has been experimentally documented by several independent approaches (protein overlay and yeast and bacterial two-hybrid systems). These interactions were clearly confirmed by the BACTH system ftsl-ftsq-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 our results indicate that FtsQ could associate with nearly all the tested Fts proteins, although with quite different efficiencies. ftsl-ymgf 1 3 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsb-ftsl 1 4 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers Coexpression of FtsL reduced complementation between T18-FtsB and T25-FtsL, suggesting free FtsL competed with T25-FtsL for binding to T18-FtsB. ftsi-ftsl 1 8 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2, 4 FtsB and FtsL formed heterodimers FtsI1-70 displayed reduced binding to FtsL. ftsl-ftsn 1 8 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers ftsb-ftsi 1 4 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsb-ftsl-1 1 4 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsb-ftsn 1 4 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsb-ftsq 1 6 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 FtsB and FtsL formed heterodimers, ftsi-ftsq-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2, 3 Interactions of FtsQ with FtsA and FtsI were clearly confirmed here by BACTH assays. FtsQ1-266 displayed diminished binding to FtsI as compared to wild-type FtsQ. ftsb-ftsq-1 1 4 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5 we found that overexpression of FtsL strongly enhanced association between T18-FtsB and T25-FtsQ Overexpression of FtsL enhanced association between FtsB and FtsQ. This could be due to overexpressed FtsL stabilizing T18-FtsB hybrids or stabilizing the complex between FtsB and FtsQ. ftsb-ftsw 1 8 unspecified role unspecified role ancillary ancillary 4 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5 upon overexpression of FtsL, T18-FtsB was shown to complement efficiently T25-FtsW whereas no complementation was detected between these two hybrid proteins in cells expressing normal levels of FtsL. This interaction only occurred in the presence of overexpression of FtsL. As FtsL can interact with FtsB and FtsW, this suggests that FtsL may bridge the two hybrid proteins to form a ternary complex. ftsb-ftsi-1 1 4 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role ancillary ancillary physical association physical association 5 in DHM1 cells overexpressing FtsL, a weak complementation between T18-FtsB and T25-FtsI could be detected. This interaction only occurs in the presence of overexpressed FtsL. As FtsL can interact with FtsB and FstsI, it suggests that FtsL may bridge the two hybrid proteins and form a ternary complex.