IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Plant Mol. Biol. (0167-4412) 2004 imex curation Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu 14-May-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu Accepted 2008-MAY-29 by CDEROW. 14-May-2008: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2004 IMEx Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Plant Mol. Biol. (0167-4412) 2004 imex curation Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu 14-May-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse two hybrid reverse two hybrid predetermined predetermined participant predetermined Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu Accepted 2008-MAY-29 by CDEROW. 14-May-2008: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2004 IMEx Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. Plant Mol. Biol. (0167-4412) 2004 imex curation Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu 14-May-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Yang Y., Jack T. I found this paper to be partcularly tedious and difficult to curate, I tried to curate it as simply as possible but would welcome any comments on it. thomas.p.jack@dartmouth.edu Accepted 2008-MAY-29 by CDEROW. 14-May-2008: Contacted by JYOTI. Plant Mol. Biol. (0167-4412) 2004 IMEx pist_arath Floral homeotic protein PISTILLATA PI At5g20240 F5O24.130 Transcription factor PI protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMIDYCCPSMDLGAMLDQYQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQMEILISKRRNEKMMAEEQRQLTFQLQQQEMAIASNARGMMMRDHDGQFGYRVQPIQPNLQEKIMSLVID 49728735AC883CCA sep1_arath Developmental protein SEPALLATA 1 Agamous-like MADS-box protein AGL2 SEP1 AGL2 At5g15800 F14F8_180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML DIP protein P29382 original sequence version: 112 867906D8D657621E ag_arath Floral homeotic protein AGAMOUS F13C5.130 AG At4g18960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV 4E7591AD85654C1C sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI DIP protein O22456 original sequence version: 117 DIP protein O22456 original sequence version: 110 0057CABD3F1AFC40 ap3_arath Floral homeotic protein APETALA 3 AP3 At3g54340 T12E18_30 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLVDNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE 669070319F9857C3 ap1_arath Floral homeotic protein APETALA 1 Agamous-like MADS-box protein AGL7 AP1 AGL7 At1g69120 F4N2.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA DIP protein P35631 original sequence version: 125 01E26DE18CE3478C sep2_arath Developmental protein SEPALLATA 2 Agamous-like MADS-box protein AGL4 SEP2 AGL4 At3g02310 F14P3.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML DIP protein P29384 original sequence version: 107 53136FE263389943 sep1-ap3 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. SEP1, SEP2, and SEP3 proteins interact with MADS-deleted versions of AP3 (AP3�IKC) sep2-ap3 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. SEP1, SEP2, and SEP3 proteins interact with MADS-deleted versions of AP3 (AP3�IKC) sep3-ap3 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. SEP1, SEP2, and SEP3 proteins interact with MADS-deleted versions of AP3 (AP3�IKC) sep3-pi 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 7 unspecified role unspecified role prey prey physical association physical association Figure 2 and Figure 4 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-pi-1 1 10 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-pi 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 5 unspecified role unspecified role prey prey physical association physical association Figure 2 and Figure 4 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. SEP1, SEP2, and SEP3 proteins interact with MADS-deleted versions of AP3 (AP3�IKC) sep2-ap1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. The authors state that this interaction was judged to be very weak , slightly above background levels. sep3-ap1-1 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. This interaction was judged to be weak by the authors sep3-ag-1 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 7 unspecified role unspecified role prey prey physical association physical association 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-ag-1 1 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-ag-2 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 5 unspecified role unspecified role prey prey physical association physical association 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-ap1-1 1 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 5 unspecified role unspecified role prey prey physical association physical association 2 The APETALA 3 (AP3) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep3-pi-1 1 4 unspecified role unspecified role prey prey P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:41:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu132pro' Tue Jun 30 17:49:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu132Pro' P48007:p.Ile142Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I P Wed May 02 18:48:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile142pro' Tue Jun 30 17:01:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile142Pro' P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 14:25:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser145pro' Tue Jun 30 18:10:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser145Pro' P48007:p.Ala154Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A P Wed May 02 19:17:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala154pro' Tue Jun 30 16:59:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala154Pro' P48007:p.Leu87Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 14:34:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu87pro' Tue Jun 30 19:34:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu87Pro' P48007:p.Leu103Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:43:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu103pro' Tue Jun 30 20:04:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu103Pro' P48007:p.Gln102Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 18:30:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln102pro' Tue Jun 30 16:14:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln102Pro' P48007:p.Gly110Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 16:21:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly110pro' Tue Jun 30 19:07:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly110Pro' P48007:p.Leu116Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:35:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116pro' Tue Jun 30 16:07:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Pro' P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:57:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu121pro' Tue Jun 30 17:30:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu121Pro' P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A P Wed May 02 17:04:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala127pro' Tue Jun 30 17:42:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala127Pro' P48007:p.Gly131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 18:08:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly131pro' Tue Jun 30 19:30:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly131Pro' P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:09:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu143pro' Tue Jun 30 17:11:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu143Pro' P48007:p.Asn149Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain N P Wed May 02 16:46:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn149pro' Tue Jun 30 20:14:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn149Pro' P48007:p.Leu160Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:18:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160pro' Tue Jun 30 16:08:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Pro' P48007:p.Gln167Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 20:11:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln167pro' Tue Jun 30 19:10:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln167Pro' P48007:p.Gly177Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 15:02:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly177pro' Tue Jun 30 18:46:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly177Pro' P48007:p.Met153Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain M P Wed May 02 17:34:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met153pro' Tue Jun 30 19:23:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met153Pro' 7 unspecified role unspecified role bait bait O22456:p.Arg146Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:42:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg146glu' Tue Jun 30 20:23:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg146Glu' physical association physical association Figure 3 Figure 5 SEP1, SEP2, and SEP3 proteins interact with MADS-deleted versions of AP3 (AP3�IKC) and PI (PI�IKC). Note that the interaction strength is only between 5�30% of the AP3�IKC/PI�IKC interaction. Mutations Gln102Pro and Gly110Pro only slightly reduced affinity for the P1 protein for the SEP3 protein. Unfortunately this cannot be quantified since the value for each is not provided, but it appears to be a reduction in value comapred to wild type PI affinity for SEP3 of less than 5% (percent). pi-ap3 1 4 unspecified role unspecified role bait bait P48007:p.Asn149Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain N P Wed May 02 16:38:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn149pro' Tue Jun 30 15:42:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn149Pro' P48007:p.Leu160Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:46:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160pro' Tue Jun 30 19:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Pro' P48007:p.Gln167Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 19:52:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln167pro' Tue Jun 30 18:04:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln167Pro' P48007:p.Gly177Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 17:22:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly177pro' Tue Jun 30 18:32:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly177Pro' P48007:p.Leu87Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:06:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu87pro' Tue Jun 30 17:21:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu87Pro' P48007:p.Gln102Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 15:20:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln102pro' Tue Jun 30 18:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln102Pro' P48007:p.Leu103Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 14:54:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu103pro' Tue Jun 30 18:13:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu103Pro' P48007:p.Gly110Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 15:47:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly110pro' Tue Jun 30 18:19:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly110Pro' P48007:p.Leu116Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:30:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116pro' Tue Jun 30 19:23:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Pro' P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:59:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu121pro' Tue Jun 30 17:53:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu121Pro' P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A P Wed May 02 19:48:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala127pro' Tue Jun 30 19:35:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala127Pro' P48007:p.Ile142Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I P Wed May 02 17:13:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile142pro' Tue Jun 30 17:48:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile142Pro' P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:02:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu143pro' Tue Jun 30 18:15:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu143Pro' P48007:p.Ile91Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T Wed May 02 15:31:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile91thr' Tue Jun 30 18:30:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile91Thr' P48007:p.Asn98Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N D Wed May 02 19:48:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn98asp' Tue Jun 30 20:07:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn98Asp' P48007:p.Leu101Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:17:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu101ala' Tue Jun 30 20:15:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu101Ala' P48007:p.Leu105His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L H Wed May 02 16:13:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu105his' Tue Jun 30 19:57:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu105His' P48007:p.Leu116Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 15:43:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116arg' Tue Jun 30 18:52:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Arg' P48007:p.Leu108Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S Wed May 02 19:49:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu108ser' Tue Jun 30 18:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu108Ser' P48007:p.Gly110Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:50:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly110ala' Tue Jun 30 19:19:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly110Ala' P48007:p.Leu121Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:14:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu121ala' Tue Jun 30 17:28:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu121Ala' P48007:p.Val124Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V D Wed May 02 17:00:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val124asp' Tue Jun 30 17:08:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val124Asp' P48007:p.Ile128Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T Wed May 02 18:54:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile128thr' Tue Jun 30 19:30:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile128Thr' P48007:p.Val135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:30:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val135ala' Tue Jun 30 17:12:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val135Ala' P48007:p.Ile94Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T Wed May 02 17:16:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile94thr' Tue Jun 30 16:20:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile94Thr' P48007:p.Met153Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain M P Wed May 02 17:58:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met153pro' Tue Jun 30 20:18:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met153Pro' P48007:p.Gly131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G P Wed May 02 17:08:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly131pro' Tue Jun 30 17:18:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly131Pro' P48007:p.Gly131Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 14:37:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly131val' Tue Jun 30 18:51:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly131Val' P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 20:11:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu132pro' Tue Jun 30 19:03:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu132Pro' P48007:p.Ala154Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A P Wed May 02 17:17:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala154pro' Tue Jun 30 15:55:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala154Pro' P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 19:56:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser145pro' Tue Jun 30 19:36:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser145Pro' 8 unspecified role unspecified role prey prey physical association physical association Figure 3 and Figure 4 PI mutants in different regions of the K domain exhibit differential effects on the strength of PI/AP3 and PI/SEP3 (or PI/SEP1) interaction sep1-ap3-p1 3 4 unspecified role unspecified role prey prey P48007:p.Leu121Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:02:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu121pro' Tue Jun 30 16:24:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu121Pro' P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:32:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu143pro' Tue Jun 30 16:32:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu143Pro' P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 16:57:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser145pro' Tue Jun 30 17:15:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser145Pro' 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 3C Mutations in K2 and the amino-terminal portion of K3 are defective in forming AP3/PI/SEP1 ternary complexes sep3-pi-3 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:52:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu121pro' Tue Jun 30 16:14:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu121Pro' P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A P Wed May 02 19:59:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala127pro' Tue Jun 30 16:47:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala127Pro' P48007:p.[Glu129Lys;Leu132Pro] glu129lys-lys132pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu129lys,leu132pro' Tue Jun 30 19:37:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu129Lys;Leu132Pro]' P48007:p.Ile142Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I F Wed May 02 14:45:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile142phe' Tue Jun 30 19:32:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile142Phe' P48007:p.[Ala154Pro;Gln157Glu;Phe162Leu] ala154pro-gln157glu-phe162leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain A P Fri Jul 22 10:55:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln157glu,phe162leu,ala154pro' Wed May 02 15:12:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala154pro,gln157glu,phe162leu' Tue Jun 30 16:41:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala154Pro;Gln157Glu;Phe162Leu]' P48007:p.[Leu116Pro;Met152Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain M T Wed May 02 17:27:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116pro,met152thr' Tue Jun 30 19:30:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu116Pro;Met152Thr]' P48007:p.[Asn89Ser;Met152Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N S certain certain sequence position certain certain certain sequence position certain M V Wed May 02 17:03:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn89ser,met152val' Tue Jun 30 19:28:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn89Ser;Met152Val]' P48007:p.[Asp99Gly;Gln199Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q G certain certain sequence position certain certain certain sequence position certain D G Wed May 02 14:42:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp99gly,gln199gly' Tue Jun 30 16:18:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp99Gly;Gln199Gly]' P48007:p.[Arg158Gln;Glu168Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R Q certain certain sequence position certain certain certain sequence position certain E V Wed May 02 17:05:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg158gln,glu168val' Tue Jun 30 19:50:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg158Gln;Glu168Val]' P48007:p.Pro193Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P L Wed May 02 16:19:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro193leu' Tue Jun 30 16:06:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro193Leu' P48007:p.[Glu141Arg;Pro193Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain P L Wed May 02 15:15:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu141arg,pro193leu' Tue Jun 30 16:35:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu141Arg;Pro193Leu]' P48007:p.[Asp112Gly;Arg176Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D G certain certain sequence position certain certain certain sequence position certain R G Wed May 02 19:15:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp112gly,arg176gly' Tue Jun 30 16:47:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp112Gly;Arg176Gly]' P48007:p.[Leu118Pro;Asn149Asp;Leu160Pro] leu118pro-asn149asp-leu160pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain N D Fri Jul 22 11:13:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu118pro,leu160pro,asn149asp' Wed May 02 17:05:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu118pro,asn149asp,leu160pro' Tue Jun 30 17:32:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu118Pro;Asn149Asp;Leu160Pro]' P48007:p.[Leu105Pro;Asp112Ala;Glu125Gly;Val206Ala] leu105pro-asp112ala-glu125gly-val206ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain V A Wed May 02 16:53:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu105pro,asp112ala,glu125gly,val206ala' Tue Jun 30 19:37:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu105Pro;Asp112Ala;Glu125Gly;Val206Ala]' P48007:p.Glu125Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E G Wed May 02 20:10:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu125gly' Tue Jun 30 15:40:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu125Gly' P48007:p.Val124Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V D Wed May 02 17:10:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val124asp' Tue Jun 30 19:17:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val124Asp' P48007:p.Ile128Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I F Wed May 02 18:09:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile128phe' Tue Jun 30 18:25:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile128Phe' P48007:p.Ile128Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I V Wed May 02 16:05:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile128val' Tue Jun 30 16:41:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile128Val' P48007:p.Glu129Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E D Wed May 02 16:32:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu129asp' Tue Jun 30 15:39:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu129Asp' P48007:p.Lys151Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:14:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys151glu' Tue Jun 30 15:45:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys151Glu' P48007:p.Leu164Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L Q Wed May 02 16:08:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu164gln' Tue Jun 30 17:27:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu164Gln' P48007:p.[Phe162Leu;Met203Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain M T Wed May 02 14:35:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe162leu,met203thr' Tue Jun 30 19:46:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe162Leu;Met203Thr]' P48007:p.[Met122Lys;Glu141Lys;Met178Val] met122lys-glu141lys-met178val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain M V certain certain sequence position certain certain certain sequence position certain M K Fri Jul 22 10:58:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu141lys,met178val,met122lys' Wed May 02 16:51:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met122lys,glu141lys,met178val' Tue Jun 30 15:35:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met122Lys;Glu141Lys;Met178Val]' P48007:p.[Ser115Phe;Lys119Ile;Asn120Ile] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K I certain certain sequence position certain certain certain sequence position certain N I certain certain sequence position certain certain certain sequence position certain S F Wed May 02 17:15:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser115phe,lys119ile,asn120ile' Tue Jun 30 20:02:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser115Phe;Lys119Ile;Asn120Ile]' P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:33:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu143pro' Tue Jun 30 17:10:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu143Pro' P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:46:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu132pro' Tue Jun 30 18:07:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu132Pro' physical association physical association Table 1 PI mutants isolated in the PI/SEP3 reverse two-hybrid screen. sep1-ap1-2 1 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. However, when both the MADS and I domains are deleted from AP1 (AP1�KC), both SEP1 and SEP3 interact strongly with AP1�KC ap1-sep2 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry In summary, these results demonstrate that SEP1, SEP2, and SEP3 are capable of interacting in yeast two-hybrid assays with several MADS proteins including AP3, PI, AP1 and AG. ap1-sep3-3 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. However, when both the MADS and I domains are deleted from AP1 (AP1�KC), both SEP1 and SEP3 interact strongly with AP1�KC ap1 1 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. ap3-sep3 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. In summary, these results demonstrate that SEP1, SEP2, and SEP3 are capable of interacting in yeast two-hybrid assays with several MADS proteins including AP3, PI, AP1 and AG.