UniProt UniProt http://www.uniprot.org Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. J. Cell. Sci. (0021-9533) 2004 Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast cosedimentation cosedimentation antibody detection identification by antibody antibody detection Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. Accepted 2007-NOV-22 by JYOTI. J. Cell. Sci. (0021-9533) 2004 Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. J. Cell. Sci. (0021-9533) 2004 Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column antibody detection identification by antibody antibody detection Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. Accepted 2007-NOV-22 by JYOTI. J. Cell. Sci. (0021-9533) 2004 Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. J. Cell. Sci. (0021-9533) 2004 Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom antibody detection identification by antibody antibody detection Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. Accepted 2007-NOV-22 by JYOTI. J. Cell. Sci. (0021-9533) 2004 Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. Sem1, the yeast ortholog of a human BRCA2-binding protein, is a component of the proteasome regulatory particle that enhances proteasome stability. J. Cell. Sci. (0021-9533) 2004 Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Funakoshi M., Li X., Velichutina I., Hochstrasser M., Kobayashi H. CoIps have been done with and without ATP. Accepted 2007-NOV-22 by JYOTI. J. Cell. Sci. (0021-9533) 2004 rpn7_yeast 26S proteasome regulatory subunit RPN7 RPN7 P8283.8 YPR108W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV B21B66CD818E636D B21B66CD818E636D prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C 8454BBC9D549EC5C rpn2_yeast 26S proteasome regulatory subunit RPN2 RPN2 SEN3 YIL075C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLTTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKDVNAPLPTPFKVDDNVDFPSA 881E78EBC6BD934F 881E78EBC6BD934F psb4_yeast Proteasome subunit beta type-4 PRE1 YER012W Proteasome component C11 Macropain subunit C11 Proteinase YSCE subunit 11 Multicatalytic endopeptidase complex subunit C11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ ED43D319A5895B40 ED43D319A5895B40 psa7_yeast Probable proteasome subunit alpha type-7 PRE10 PRC1 PRS1 O6650 YOR362C Proteasome component C1 Macropain subunit C1 Proteinase YSCE subunit 1 Multicatalytic endopeptidase complex subunit C1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE 1E51D904CF336747 1E51D904CF336747 prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F 9C59E92A0794F60F rpn12_yeast 26S proteasome regulatory subunit RPN12 RPN12 NIN1 Nuclear integrity protein 1 YFR052W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV D901AAD4D07ED3D1 D901AAD4D07ED3D1 rpn5_yeast 26S proteasome regulatory subunit RPN5 RPN5 NAS5 YDL147W D1572 Proteasome non-ATPase subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK E5DC7F8E6AE27736 E5DC7F8E6AE27736 sem1_yeast 26S proteasome complex subunit SEM1 SEM1 DSH1 YDR363W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ B66B578ABB01E672 B66B578ABB01E672 pre1-sem1-1 4 8 unspecified role unspecified role bait bait region FLAG-His6 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association The interaction was dependent on ATP. 3A and 4A pre1-rpt1-1 4 8 unspecified role unspecified role bait bait region Flag-His6 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association The interaction was dependent on ATP. 3A and 4A Interaction was decreased in cells with SEM1 deletion. pre1-pre10-1 4 8 unspecified role unspecified role bait bait region Flag-His6 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association The interaction was not dependent on ATP. 3A and 4A The interaction was independent of SEM1 deletion. rpt1-sem1-1 4 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region Flag-His6 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A The interactions was not dependent on ATP. rpt1-rpt1-1 4 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region Flag-His6 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A The interactions was not dependent on ATP. sem1-rpt6-1 2 13 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association 3B Several proteasome core particle proteins have been co-eluted (alpha2, alpha3, alpha5, alpha6 and alpha7)and immunoblotted by using the MCP123 antibody recognizing multiple CP alpha-type subunits. cannot map co-eluted CP alpha subunits to SP rpn7-rpn12-sem1-1 3 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3C rpn2-sem1-2 3 13 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C rpn5-rpn12-rpt6-1 1 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association Several proteasome core particle proteins have been co-purified (alpha2, alpha3, alpha5, alpha6 and alpha7) and immunoblotted by using the MCP123 antibody recognizing multiple CP alpha-type subunits. 4C cannot map CP-alpha subunits to SP