IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Kim JH., Kende H. hkende@msu.edu Arabidopsis cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim JH., Kende H. hkende@msu.edu Accepted 2007-DEC-23 by ORCHARD. Arabidopsis cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 orchard Only protein-protein interactions imex curation A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Kim JH., Kende H. hkende@msu.edu Arabidopsis cDNA library orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim JH., Kende H. hkende@msu.edu Accepted 2007-DEC-6 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 orchard Only protein-protein interactions imex curation A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Kim JH., Kende H. hkende@msu.edu Arabidopsis cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim JH., Kende H. hkende@msu.edu Accepted 2007-DEC-23 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 orchard Only protein-protein interactions imex curation grf2_arath Growth-regulating factor 2 GRF2 Transcription activator GRF2 T28I19.20 At4g37740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIGVHVLGSVTSNENESLGLKELIGTKQDRSGFIGEDCLQRSLKLARTTTRAEEEENLSSSVAAAYCKTMSFHQGIPLMRSASPLSSDSRRQEQMLSFSDKPDALDFSKYVGLDNSSNNKNSLSPFLHQIPPPSYFRSSGGYGSGGMMMNMSMQGNFTGVKGPFTLTQWAELEQQALIYKYITANVPVPSSLLISIKKSFYPYGSLPPSSFGWGTFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQSGQNQTAAAASKAVTTPQQPVVAGNTNRSNARASSNRSLAIGSQYINPSTESLPNNRGVSIYPSTVNLQPKESPVIHQKHRNNNNPFEFGHISSDSLLNPNTAKTYGSSFLDFSSNQEKHSGNHNHNSWPEELTSDWTQLSMSIPIASSSPSSTHNNNNAQEKTTLSPLRLSRELDLSIQTDETTIEPTVKKVNTWIPISWGNSLGGPLGEVLNSTTNSPTFGSSPTGVLQKSTFCSLSNNSSVSSPIAENNRHNGDYFHYTT E3CBB15694279DDD grf1_arath Growth-regulating factor 1 GRF1 Transcription activator GRF1 T20K9.5 At2g22840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLGVRVSGHETVSSPGQTELGSGFSNKQERSGFDGEDCWRSSKLSRTSTDGFSSSPASAKTLSFHQGIPLLRSTTINDPRKGQEHMLSFSSASGKSDVSPYLQYCRNSGYGLGGMMNTSNMHGNLLTGVKGPFSLTQWAELEQQALIYKYITANVPVPSSLLLSLKKSFFPYGSLPPNSFGWGSFHLGFSGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEGQNGHNTNAAAAASAAAASTAAAVSKAAAGTSAVAMRGSDNNNSLAAAVGTQHHTNNQSTDSLANRVQNSRGASVFPATMNLQSKETHPKQSNNPFEFGLISSDSLLNPSHKQASYATSSKGFGSYLDFGNQAKHAGNHNNVDSWPEELKSDWTQLSMSIPMAPSSPVQDKLALSPLRLSREFDPAIHMGLGVNTEFLDPGKKTNNWIPISWGNNNSMGGPLGEVLNSTTNSPKFGSSPTGVLQKSTFGSLSNSSSASSTIIGDNNNKNGDGKDPLGPTTLMNTSATAPSL 6E478B781BDA301D gif2_arath GRF1-interacting factor 2 GIF2 Transcription coactivator GIF2 F6F3_1 T25K16.15 At1g01160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQQQQSPQMFPMVPSIPPANNITTEQIQKYLDENKKLIMAIMENQNLGKLAECAQYQALLQKNLMYLAAIADAQPPPPTPGPSPSTAVAAQMATPHSGMQPPSYFMQHPQASPAGIFAPRGPLQFGSPLQFQDPQQQQQIHQQAMQGHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQDGADGQGKDDGK 69A453024E75EE67 gif1_arath GRF1-interacting factor 1 GIF Protein ANGUSTIFOLIA 3 Transcription coactivator GIF1 F4I4.20 At5g28640 GIF1 AN3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN 4C3FEE1B8C22DE13 grf1-gif1 1 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Thus, of the 193 interacting proteins, 178 were encoded by GIF1 and 5 by GIF2, which is strong evidence that GIF1 and GIF2 are partner proteins of GRF1. grf1-gif2 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Thus, of the 193 interacting proteins, 178 were encoded by GIF1 and 5 by GIF2, which is strong evidence that GIF1 and GIF2 are partner proteins of GRF1. grf1-gif1-1 3 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Yeast cells expressing both GRF1 and GIF1 grew on His-deficient medium and gave the color reaction for -galactosidase activity, but none of the other combinations of GRF1 or GIF1 gave a positive response, thereby confirming the screening result 2 grf2-gif1 3 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Yeast cells expressing both GRF1 and GIF1 grew on His-deficient medium and gave the color reaction for -galactosidase activity, but none of the other combinations of GRF1 or GIF1 gave a positive response, thereby confirming the screening result 2 gif1-grf1 2 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Among the fragments containing the QLQ, WRC, or C-terminal domains of GRF1, only that containing the QLQ domain was able to bind to GIF1 The coordinates for the GRF1 construct containing the QLQ region was taken from Figure 1, but the authors do not provide the coordinates in the text. 3 grf1-grf1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Only the SNH but not the QG domain of GIF1 was able to bind GRF1 the authors do not provide the coordinates for the SNH domain of the GIF1 protein which interacted with GRF1. It was not possible to determine the coordinates of this domain and therefore this information is missing from this entry. 3