IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Development (0950-1991) 2004 Samanta J., Kessler JA. jakessler@northwestern.edu 10-APR-2007: Contacted by JYOTI. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. jakessler@northwestern.edu Accepted 2007-APR-20 by JYOTI. 10-APR-2007: Contacted by JYOTI. Development (0950-1991) 2004 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Development (0950-1991) 2004 Samanta J., Kessler JA. jakessler@northwestern.edu 10-APR-2007: Contacted by JYOTI. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. Cells were treated with 20ng/ml BMP4 for 12 hours jakessler@northwestern.edu Accepted 2007-APR-20 by JYOTI. 10-APR-2007: Contacted by JYOTI. Development (0950-1991) 2004 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Development (0950-1991) 2004 Samanta J., Kessler JA. jakessler@northwestern.edu 10-APR-2007: Contacted by JYOTI. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. jakessler@northwestern.edu Accepted 2007-APR-20 by JYOTI. 10-APR-2007: Contacted by JYOTI. Development (0950-1991) 2004 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Development (0950-1991) 2004 Samanta J., Kessler JA. jakessler@northwestern.edu 10-APR-2007: Contacted by JYOTI. mouse-brain Mus musculus brain brain Brain [cerebrum] confocal microscopy confocal microscopy immunostaining immunostaining Samanta J., Kessler JA. Cells were treated with BMP4 20ng/ml for 12 hours jakessler@northwestern.edu Accepted 2007-APR-20 by JYOTI. 10-APR-2007: Contacted by JYOTI. Development (0950-1991) 2004 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. Development (0950-1991) 2004 Samanta J., Kessler JA. jakessler@northwestern.edu 10-APR-2007: Contacted by JYOTI. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Samanta J., Kessler JA. jakessler@northwestern.edu Accepted 2007-APR-20 by JYOTI. 10-APR-2007: Contacted by JYOTI. Development (0950-1991) 2004 p15806-2 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQLHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL DIP protein P15806-2 original sequence version: 91 Contains a phosphothreonine at position 528. Contains a phosphoserine at position 533. 5C1B68DDBF29A93B p15806-1 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL 7904ABB37B8D39CB olig1_mouse Oligodendrocyte transcription factor 1 Olig1 Oligodendrocyte-specific bHLH transcription factor 1 protein protein mouse Mus musculus Mouse MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK 5EA8A74D9DF0D310 olig2_mouse Oligodendrocyte transcription factor 2 Olig2 protein protein mouse Mus musculus Mouse MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMGASGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPTATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGTLPRLTSDAK 598AE76CB512D716 id4_mouse DNA-binding protein inhibitor ID-4 Id4 Id-4 Idb4 Inhibitor of DNA binding 4 Inhibitor of differentiation 4 protein protein mouse Mus musculus Mouse MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR 2DCFF47AF7EE7EED id2_mouse DNA-binding protein inhibitor ID-2 Id2 Id-2 Idb2 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 protein protein mouse Mus musculus Mouse MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG DIP protein P41136 original sequence version: 92 A0D98D54F2686CC5 olig1-id4-1 3 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 olig2-id4-1 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 olig1-e47-1 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7A both OLIG1 and OLIG2 interact with the E2A proteins, E12 and E47 olig2-e47-1 3 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7B both OLIG1 and OLIG2 interact with the E2A proteins, E12 and E47 id4-olig1-1 1 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 id2-olig1-1 1 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 id4-olig2-1 1 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 id2-olig2-1 1 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5B OLIG1 and OLIG2 complexed with both ID2 and ID4 e12-olig1-1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7A both OLIG1 and OLIG2 interact with the E2A proteins, E12 and E47 e12-olig2-1 1 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7B both OLIG1 and OLIG2 interact with the E2A proteins, E12 and E47 olig1-id2-1 2 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 6B we observed similar interactions between endogenous levels of OLIG and ID2 or ID4 proteins in E17 progenitor cells olig1-id4-2 2 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 6B we observed similar interactions between endogenous levels of OLIG and ID2 or ID4 proteins in E17 progenitor cells id2-olig1-2 2 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 6B we observed similar interactions between endogenous levels of OLIG and ID2 or ID4 proteins in E17 progenitor cells id2-olig2-2 2 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 6C we observed similar interactions between endogenous levels of OLIG and ID2 or ID4 proteins in E17 progenitor cells id4-olig2-2 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 6C we observed similar interactions between endogenous levels of OLIG and ID2 or ID4 proteins in E17 progenitor cells olig1-id2-2 5 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Table 1 Bacterial two-hybrid and co-immunoprecipitation studies demonstrated that ID4, and to a lesser extent ID2, complexed with the basic-helix-loop-helix transcription (bHLH) factors OLIG1 and OLIG2 olig1-id4-3 5 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Table 1 Bacterial two-hybrid and co-immunoprecipitation studies demonstrated that ID4, and to a lesser extent ID2, complexed with the basic-helix-loop-helix transcription (bHLH) factors OLIG1 and OLIG2 olig2-id2-1 5 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 1 Bacterial two-hybrid and co-immunoprecipitation studies demonstrated that ID4, and to a lesser extent ID2, complexed with the basic-helix-loop-helix transcription (bHLH) factors OLIG1 and OLIG2 olig2-id4-2 5 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 1 Bacterial two-hybrid and co-immunoprecipitation studies demonstrated that ID4, and to a lesser extent ID2, complexed with the basic-helix-loop-helix transcription (bHLH) factors OLIG1 and OLIG2 olig1-id2-3 4 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A Both OLIG1 and OLIG2 colocalized with ID2 and ID4 in the cultured cells. olig1-id4-4 4 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A Both OLIG1 and OLIG2 colocalized with ID2 and ID4 in the cultured cells. olig2-id2-2 4 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A after BMP4 treatment OLIG2 was localized predominantly in the cytoplasm in association with ID4 and ID2. olig2-id4-3 4 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A after BMP4 treatment OLIG2 was localized predominantly in the cytoplasm in association with ID4 and ID2.