IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The alpha4 and alpha7 subunits and assembly of the 20S proteasome. The alpha4 and alpha7 subunits and assembly of the 20S proteasome. FEBS Lett. (0014-5793) 2004 Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk Accepted 2007-OCT-25 by JYOTI. FEBS Lett. (0014-5793) 2004 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. The alpha4 and alpha7 subunits and assembly of the 20S proteasome. FEBS Lett. (0014-5793) 2004 Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk Accepted 2007-OCT-25 by JYOTI. FEBS Lett. (0014-5793) 2004 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. The alpha4 and alpha7 subunits and assembly of the 20S proteasome. FEBS Lett. (0014-5793) 2004 Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk Accepted 2007-OCT-25 by JYOTI. FEBS Lett. (0014-5793) 2004 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. The alpha4 and alpha7 subunits and assembly of the 20S proteasome. FEBS Lett. (0014-5793) 2004 Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk Accepted 2007-OCT-25 by JYOTI. FEBS Lett. (0014-5793) 2004 psa4_human Proteasome subunit alpha type-4 PSMA4 PSC9 Proteasome component C9 Macropain subunit C9 Multicatalytic endopeptidase complex subunit C9 Proteasome subunit L HC9 protein protein human Homo sapiens Human MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK DIP protein P25789 original sequence version: 160 DIP protein P25789 original sequence version: 133 DIP protein P25789 original sequence version: 114 DIP protein P25789 original sequence version: 149 7867422B1B31F3B9 psa5_human Proteasome subunit alpha type-5 PSMA5 Proteasome zeta chain Macropain zeta chain Multicatalytic endopeptidase complex zeta chain protein protein human Homo sapiens Human MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI DIP protein P28066 original sequence version: 166 5610CDA00469120A psa2_human Proteasome subunit alpha type-2 PSMA2 PSC3 Proteasome component C3 Macropain subunit C3 Multicatalytic endopeptidase complex subunit C3 HC3 protein protein human Homo sapiens Human MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA DIP protein P25787 original sequence version: 161 63CB56A233583836 psa3_human Proteasome subunit alpha type-3 PSMA3 PSC8 Proteasome component C8 Macropain subunit C8 Multicatalytic endopeptidase complex subunit C8 HC8 protein protein human Homo sapiens Human MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM DIP protein P25788 original sequence version: 173 A1854ED3C0650FB1 psa1_human Proteasome subunit alpha type-1 PSMA1 PROS30 PSC2 Proteasome component C2 Macropain subunit C2 Multicatalytic endopeptidase complex subunit C2 Proteasome nu chain 30 kDa prosomal protein HC2 NU protein protein human Homo sapiens Human MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH DIP protein P25786 original sequence version: 102 DIP protein P25786 original sequence version: 174 3F159C5BCEFE8DED psa6_human Proteasome subunit alpha type-6 PSMA6 PROS27 Proteasome iota chain Macropain iota chain Multicatalytic endopeptidase complex iota chain 27 kDa prosomal protein protein protein human Homo sapiens Human MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD DIP protein P60900 original sequence version: 129 DIP protein P60900 original sequence version: 80 94D1FD3C0A7CC72A psa7_human Proteasome subunit alpha type-7 PSMA7 Proteasome subunit RC6-1 Proteasome subunit XAPC7 HSPC protein protein human Homo sapiens Human MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS DIP protein O14818 original sequence version: 160 DIP protein O14818 original sequence version: 149 5DD0276A1C2DEF91 alpha2-alpha4-1 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1 The α4 subunit also interacts with α2 alpha2-alpha7 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha7-alpha6-1 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha7-alpha7 2 11 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha6-alpha7-1 2 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha4-alpha7-1 2 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha3-alpha7 2 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha1-alpha7-1 2 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1 Furthermore, we have identified interactions between the α7 subunit (HC8) of the 20S α-ring, and the α1, α2, α3, α4, α6 and α7 subunits alpha7-alpha1-1 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha3 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha4-1 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha6-2 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha7-1 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha6-alpha4 3 5 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha6-alpha7-2 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha5-alpha4 3 5 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha5-alpha7 3 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha4-alpha3-1 3 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha4-alpha4 3 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha4-alpha7-2 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha3-alpha4-2 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha3-alpha7-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha2-alpha7-1 3 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha2-alpha4-2 3 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha1-alpha7-2 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha1-alpha4-1 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 3 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha1-alpha2-2 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association 4 Distribution of the α-subunits in soluble extracts of HEK 293 cells. alpha4-alpha7-3 1 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 5 Immunoblot analysis of α4-precipitated proteins revealed bands of approximately 27 and 28 kDa predominately in fractions 5 and 6 corresponding to the α7 subunit