IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular interactions of fission yeast Skp1 and its role in the DNA damage checkpoint. Molecular interactions of fission yeast Skp1 and its role in the DNA damage checkpoint. Genes Cells (1356-9597) 2004 Lehmann A., Katayama S., Harrison C., Dhut S., Kitamura K., McDonald N., Toda T. Both wild-type skp1 and mutant temperature sensitive skp1 (I110T) were used as bait in each interaction. toda@cancer.org.uk in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lehmann A., Katayama S., Harrison C., Dhut S., Kitamura K., McDonald N., Toda T. Both wild-type skp1 and mutant temperature sensitive skp1 (I110T) were used as bait in each interaction. toda@cancer.org.uk Accepted 2007-JAN-23 by JYOTI. Genes Cells (1356-9597) 2004 pof3_schpo F-box/TPR repeat protein pof3 pof3 SPCC338.16 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNNYQVKAIKEKTQQYLSKRKFEDALTFITKTIEQEPNPTIDLFELRAQVYEKSGQYSQAELDAKRMIHLNARNARGYLRLGKLLQLDGFDKKADQLYTQGLRMVHKMDPLRPVLKKVSQRLNERILRTRPVLDLFRILPREVLLCILQQLNFKSIVQCMQVCKHWRDCIKKEPSLFCCLDFSCASPRSVNSRDRNVMAVARYSVYSKDNIQEVIGLEKLGILTPTKALLRSVKSLKVYKTISPLHTQSTDKLYTIWTPFSELHYFYCATPITFSIASKILSCCKKLKQVELVDLIPDLIFDSMDWDKLFNAESVPLALKSLTFIRNQKFPFHHKEQQFLKDLLSASPYLEYLEASYQSDLVAAIKKYKINLRSLIIIDEGVSNTVKDLAFLPQSLTTLIVKPCNPASTILCPYLFPTNVRMESLINLELFLYLRLSQNDIDNVVKFLTSCYKLKKLVLHDSLALAPHFFEIFASLPELEHLEIPDNVALQNKHAIHITDCCPNLKYVNFSNSISLDGSGFIAVLRGLKELKRIDIINCDSVSRDAIDWARSKGMQVTVASSLPNSQPLGTKKIRLI 507D7901C1980D3F pop2_schpo WD repeat-containing protein pop2 Proteolysis factor sud1 pop2 sud1 SPAC4D7.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLSRCPTDNSSSRINSSVPLINSSSPATPPESFDPQVFPSSLIHGDNLLPQDDQIASDPRSESNSCNGNTSSSLPCTDSYQYPLKHSCTPSFLRKFNESIENVSYKCLDHSPPDSVPGDFSISLVPQRNFLYSHSSLPPKIISIDRNNRIKLDNSISSNSDNFPPSPKVDTSNTVSPGSKPISEDLEDLNLQSIVQTFEDLPEGIQSYAFFQLLRSCNRQSMRLLLNECEPLLKKDILSNLPFSIVQSILLNLDIHSFLSCRLVSPTWNRILDVHTSYWKHMFSLFGFQINENDWKYANPNLNRPPFLHNDQISDDYFPEIFKRHFLNRKRWLFPSIPPSHLSFPIHVPNFMITSLLLHKDRIITTSGSGTIQIHNAITGVLEARLEGHKEGVWAVKIHENTLVSGSIDKTVRVWNIEKAKCTHIFRGHISIIRCLEILVPSRLIRHGVEIVEPDQPYIVSGSRDHTLRVWKLPKNTDPPYLPDNTNSIDRWEKNPYFVHTLIGHTDSVRTISGYGDILVSGSYDSSIRIWRVSTGECLYHLRGHSLRIYSVLYEPERNICISGSMDKSIRVWDLSTGTCKYVLEGHDAFVTLLNVFQNRLISGSADSTIRIWDLNTGKPLMVLPSNSGYISSFVSDEHKIISGNDGSVKLWDVRTGKLLRFLLTDLTKIWHVDFDAMRCVAAVQRDDQAYLEVINFSGSRP 0336A0568C152396 skp1_schpo Suppressor of kinetochore protein 1 skp1 psh1 sph1 SPBC409.05 P19/Skp1 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEINVPIPLPNVSSNVLRKVLEWCEHHKNDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR 07EA1E97A3556E78 pof12_schpo F-box protein pof12 pof12 SPBC56F2.01 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTDVKAKNPASIFSHETLLHVLNDLSAHDLAALERVSRSWNSIVRRSSVWHNLYLSEFGTKHLRRHGRIEKKRRNWKGLFRRQSNWKDGRCKKVESMLPQLLNSEKSVGEDRLGLTLTHQNNIYFCNDVQISKWSSVGNSLKCQAISSFRDETVKSGPAVMCLDNASLYIGLKDGNLLHVTVHETGFGNIENLATFSTKFVALSSHKNYICGLTNDNNLYILQHSHQAGTKLKVLGKYHVSSIEKQVAIHFQQSKEGYEVVHVVFNDYVLSGGWTVSLQEFVFNEYCVKSSRLALHDNKDIEYSQQPASAIFMYGSYILTSHPDNSLILQRLYSTNNELRIKFLGRLLGHVCGVQISKLFSCGRIVSVSKNCADICVWDLHDTNYQSIVSPLMLTCTNIHNKPVSDYEKECKVQDIGLYEDTILITLSDGRILKFLFNI 471FBAC7F3921E81 fbh1_schpo F-box DNA helicase protein 1 fbh1 fdh SPBC336.01 fdh1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSAQHLHSCKFYRLPLEIIPLICRFLSVQDIQSFIRVFPSFQTILDSSNDLFWKKKNYELRIRRNRLLRGSYAAGVSSSAMNGFVNGTQISSTPAEREYYSKSDEIKNICGLPPGPMKVEQIGHAIDHLVSETHTVDHLGSSIKASFFHIDDVPLEWISSICMQVQSFFSPAAREAISSLKSRTTTSNLLLSLFVGILFEDDLWYFFNTLYMLSSTSAIEFAYFLDSIFTVVRTDYEHYRDPLSQTLITSCTRIHNIVAVIESPYDEPNTKGLTSEQKMIVECQLNPGEVLKVKAFAGTGKTKALLEFAKSRPKDKILYVAFNKAAKEDAELRFPFNVKCSTMHGLAYGAILAQADLPQAKLERQLSNSTIASLLSLQVAFPKANRKNNPGTPSASLVASHIMFTLNRFMHSTDWQLGFRHISKRSLEVTKLSKEKLLAYTKKLWSLIVNFEYTHAPLIPDAYMKLLHLYEFPNIFSKYDYILFDEAQDFTPCMVDLIYRQKHARIVIVGDAHQCIYGFRGANACAFNENLYPSTKQLCLTKSFRFGNSVAKYANFLLSLKGENVKLKGVQNDHAYWSSASNPNNVSGAFRFFPHTIIFRTNKELILQSIRLSVSLPKEIPIAILGSMRKKAFQLLRSGSELAHGQRPSHPKLKDFSSWGEFEVHVKNSAEEDAELALVYDMADELFSESFLSRLDNCEKRLMDSKDDGDNGIILATAHQSKGLEWDNVQLGNDFRPKFDSVSFSRIGSSRYLQEEINILYVALTRAKKRLILNDTITKLYALECGLVRFAGGILTEDQLQPGKVALFVDWQIDKFSFFYETPAEGYNLLVEANEKSVWDIFFGVLSGAWQNYIANTSERLKRSMLFIENQLFAVHDQ E051D904F8293C15 pof9_schpo F-box protein pof9 pof9 SPBC3H7.06c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAKSPFLELSYDILLEISTYLDYKDIVHLSETCKSLSYVFDDKTIWHRFCARVQGLTNVVPVVDDNYKRPYAVWKDRGYAYSWGQQIRNYLGRVVNTNQYPRDRPGALTGKDVRSTIQVQVGGYGMYLLNENGNLYVTGVPNNVGPELMRDLEPIVKIHAGREFCLALGETGHLYQVSLKTRICLTDEQNMLSAYRGRIANFKSGWDSHSAYVPGIGFLVWHTGRESEAQLFQPEASMKEFVLNDYVHCAGFLVYTVASPQKKGAVFRLDLDQATQHTLGRELKRFASHDPHQGWHLAGSFETFTCLSDDGNTVYMGHANTKQVDDDPVIHDFLQNRGIKQLAHGDHHHLYLTSDHSIWSWGVELRYCGCLGLGSLHLQEQTSDPSIVSDPRTARNIVSIPHQIHFSGTCYSVAAGGWQSAALAISESVLPEVNVPPITTFSIIRPSRVPALRFLAAPATRTLERDG 154909F3C9C3E6EB pof2_schpo SCF E3 ubiquitin ligase complex F-box protein pof2 F-box and leucine-rich repeat protein pof2 F-box/LRR-repeat protein pof2 pof2 SPBC25B2.11 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MRVPNEVCFNILSYLEADELRCKSTVCTSWRNFIIPTLWEKVVFQNEAQLNNFFDTLQYSKDVSYYFRYLRKLNCSRVRKFLTDKHLMLMTLATGISRLNLSGCTRISEPLIGKLLYQNLNLVTINFSNIFSLPANILEYISDNCPNLKALNIGNCGLVEDTGMVQIIKRCPYLNRLIIPNCRKLTDVSLQILSEKEDLIELDISGCEGFHNADTLSRLVSRNRGLKELSMDGCTELSHFITFLNLNCELDAMRALSLNNLPDLKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTLHLGHCYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIAKLPYLQRVGLVKCICLTDLSVILLSGSFSRNLERVHLSYCIGLTAKSVSYLMYNCKTLKHLSVTGINSILCTELRSFSRPIPDGINPSQVPVFCAFTKVEIDLFREFIRNRI 07435B3C28BB2073 cul1_schpo Cullin-1 cul1 pcu1 SPAC17G6.12 Cell division control 53 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTLNTNDKDLPIVKKYDSLNGTWDFLKTGVSQIFERLDEGMTITKYMELYTAIHNYCADASKTITVDNFNDQTANVLGEALYNNLVLYLEEYLARLRKECISQTNHEEQLAAYAKYWTRFTTSARFINHLFGYLNRYWVKLKNRFTETLVYDIYTLCLVSWHHHVFSHIRDSLLQNLLYMFTKKRLYEPTDMKYVEVCVDSITSLSFDKTDMTKPNLSSYKTFFETNFIENTKNFYAKESSEYLASHSITDYLKKAEIRLAEEEELVRLYLHESTLKPLLEATEDVLIAQHEEVLHNDFARMLDQNCSEDIIRMYRLMSRTPNGLQPLRQTFEEFVKRSGFAAVAKIVPQVGGEADVDPKEYMEMLLSTYKASKELVNTAFHGDTDFTKSLDTAFRELVNRNVVCQRSSSRSPELLAKYADSILRKSNKNVDIDDVEDCLSSIIIIFRYVEDKDVFQNFYTKLLAKRLVNGTSNSQDAESSMLSKLKEVCGFEYTSKLQRMFQDISLSQEITEAFWQLPQSRAGNIDFSALVLGTSFWPLSPNNVNFHLPEELVPLYEGFQNYYYSCHNGRKLSWLFHLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLSTDFLTGILNIFLKAKVLLLGDNDKLGDPNSTYKINENFRMKKIRVQLNLPIRSEQKQESLETHKTIEEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDMLIEKEYLERQGRDEYIYLA 458CA31B5D97FAA9 pof11_schpo F-box/WD repeat-containing protein pof11 Meiotically up-regulated gene 156 protein pof11 SPAC29E6.01 SPAC30.05 mug156 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNQDDNGKNVVSKVSDLTSCSDFSTSSPVPCLNPLSHENNRIDLIRDLLASLSKEGVVAVYNHVRSLLFTDFTEVFPEEVSLRVFSYLDQLDLCKCKLMSKRWKRLLEDPGIWKALYMQKGWFVNENVLNEFEAWRRTHKFPQPRFENFLKQQNIIGPYGTMFLPQQFIFDSNGRPLLNWSYLYKEHAHLDSNWRHGRFLVSTFNNPSIRFPADQDFRATLDSVYCVQYDDEIMVSGSKDRTVSVWDVNSRFILYKLYGHSGSVLCLDFCRRRNLLVSGSSDSTIIIWDWQNRRPLKVYFGHTDNVLGVVVSENYIISSSRDHTARVWRLDATSPAEACMHVLRGHLASVNSVQYSSKTGLIVTASSDRTLRTWDITTGHCIRIIHAHQRGIACAQYNGKFIVSGSSDLTIRIFEASSGKLLRMLQGHEDLIRTVRFNDEKIVSGGYDGTVRIWNFNTGEQHCVLHNSRNSRVFGLQFDHRRIIACTHSSEILVWNFDDGLDCTFF CEF34D4EFFBC2E10 pof5_schpo Protein pof5 pof5 SPAC6F6.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQSFPPEIWHHIFDHLISFDKFEAKNFGGLLRICRSSYVGGLHAIYYFPKLNPRNYHKFVDTISRKPTRKLVHHISLNNVSYASKASITSRLLRRCATNLETFSGPQSGLGFTALRAFSQCQKLKKIDLSILSEKIDLQYLFGGIQHLKHLEYIILPYLSIPAPMCTECWPSSLTFVGFSGGLTDDFLAESVFPPSLKSINITQCPLLTDAGIFSLLSKIGPNLSSVCVQYPMPELSRSGLDCIFQLCPNATTISIPANYITSTAFESIPESGHNVRSLEITYSGSLLTNISLIKADDLVGALVDGKLPNLHRLQWSIRLGWREESQDVQDLLELIDDQDGEVFITVK 1B9EBDEBEFD80D9B pof4_schpo Elongin-A ela1 Protein pof4 pof4 SPBC29A3.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MYSLKDLCIQVAQKHVHDIDDIGDCPFELVKPILEKARPEHLIDLEEKSPHLKVDTQPLWKDHVLRDFGLELQKRTILNNIDDWRGLYGKLKKKRNAHYNVASAKLRSAYTKLEQSKQNKRIVPLEREPRAARPPKRPRPMSNYCPKSSLMARAKSDFLKKASATRHIVSATSSSRSFPQLHPLGRSSSNATNTSTKRPLTSNTYPSIPLPPKSFTSQNFKSFNAVKTQPSSSSSPSISRPTSFPMSFFPNPSRFSSQVPKRI 9726BA49F8F0EE0E pof8_schpo La-related protein 7 homolog pof8 lar7 SPAC17G6.17 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFVPRQLNVRKIKAFTGKENNSIADGNNNKLKDEHYKHNEASKEPSHSISGGLMLNQQDRQLIEPLNPDFLSAVDSILEIYFHRERQKEKVHLAFLIQQDDFWKGIRPNPTQNNLKYALSYVTNALFHFDNSSHMVIRNENIVLPLDIPLYDRIIYVEPVPATLSNKSLLLAGKLRKYLKEFLPYVDAIGTPEGYAFVILYKKVDQSALSKLPVPPGWVLLTRKEWTNREEKYFENQLHLVKASSSDVSNSSNSFPENRYPKLTKVEKQMTKSVSKTSQTDKDEDNLDFTKNLLTRIKNLHPLTNKSTIHSLLSYVFSRQTQNIACEPMYIDYRKDETEAIIRWKTPLHAETCINAFRTQERKQNSHDDIRAHRKKGSSRPFLIAELITGEEEKNYWRMLKK 5CE59874476123C5 pof1_schpo F-box/WD repeat-containing protein pof1 Skp1-binding protein 1 pof1 sbp1 SPAC57A10.05c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTGYESVPTSEPSDNLAPRAELWQRHLLEKKEGDQSISVSAFNISSMHNELSGLSEKSRQRVEAVWAAFSEASCSERKLALQGILNNCSSSLLSFASSTLDSLVRLDFLSLLPVEISFRILSFLDARSLCQAAQVSKHWKELADDDVIWHRMCEQHINRKCEKCGWGLPLLERNTLYAAKASIQKRYERLTKRGVDQAHESSPVKKAKLDDYPTSSNEETISSVKPPSPNSDSKFFLPFKTRPWKEVYAERCRVECNWRHGRCRQVVLSGHSDGVMCLQLVRNILASGSYDATIRLWNLATFQQVALLEGHSSGVTCLQFDQCKLISGSMDKTIRIWNYRTSECISILHGHTDSVLCLTFDSTLLVSGSADCTVKLWHFSGGKRITLRGHTGPVNSVRIIRDRGLVLSGSDDSTIKIWSLETNTCLHTFSAHIGPVQSLALADSRLFSCSLDGTIKQWDIEKKKCVHTLFGHIEGVWEIAADHLRLISGAHDGVVKVWEACECVHTLKNHSEPVTSVALGDCEVVSGSEDGKIYLWLFNNAPNESPVSTQSVPISSLNGQRSNSSVQRALSSVPNYSSSLSNISTRNLNIPPSNANNDDVSIQS 7118C9379EC5C1F0 pof7_schpo F-box protein pof7 pof7 SPCC1827.08c SPCC70.11c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTVEDQLSLELETVNKDILLKKALLHYKDAIKSEREGNLGESLNKYRLAHKVHEDVESIYRRLERLQLCKRNEEEEMLNSDASEAMLTVSSVPSPTLTENESVNESVVPNILKLPDEVLLVILENCIRDLHDLRYLSSIALTCKHFAKALRADSLYRSFCYCSCEQKEWQQSIKSIEEELVEKYQQSWKTLFLKKPRSRFDGCYISVCRYFRPGTSDTSWNQPIHLITYYRYLRLYPNSTCIVYQSSNEPNDVVRNFSVQNTSLFSPMSSSPMFSNGNVALTGSWSMTPSGEMLIVYPASQTYTYVQKLQVRGIRLKWISFYSIHNYTSFTNEMPLTHNRDYVFSRVYSYTADSESLKRG 0269BAE9AEDEB5B5 pof6_schpo F-box protein pof6 pof6 SPCC18.04 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKPSEAREHAIRKIKEYLERRHKQQFKALFGCLTINIYLKIFTLISTPDLCNCRLVCRKFQQLCDYNSIYVKKLLLMNAWDVTLSRKLYYESQDGMSQANMSSNTSKGFHLQSSDKKYADSDRPKLSSSSLLSLPDQKIPFPVDYSTVQGKQVVLTVLDCVSQRVEFARLDYIKVWRALAPIYRNLAYASNTIDPIAFSAFRTPEEQSKVLKYLIRFGNSYPYGTYRQAMQNAILDMASLFEQACLDEFELGLHSRNLDLLRKFSHVLHDFSGPNAYVSMYLAKQTDFVRSFFHFDPYSLFISNNLEEIHINWNILESVVNDTIKLLESESKFSEATLPEPELVQVPYAKDILGNSLKDYVISICEHIGEEETELFLVFISGFYGLCKKFFSIPNGPALVDTIFQPQIDIFISQELHYFKTVGWSLVDQWDQKLEEKEDATECFFYKNVSQNTAKNNFLETFKNVMLLPVSLFTIPSENNSASNLAEKAIEQKEEEDPELSKLDAARFVPANIYVSKDRLKHLPTTELAAQAAVLDSKLEGISTMFSLELALKIVHLCKVSLARAKVFMGTSVPQDDDIKGLSKDLFVQLLRELGQGHLKHGFDRAIEHLSSFDPRRDFSSNTVEPVVKFLELINVGDMIQQMMDSFFNEEMSPICVKDDMFDPAIAEKKKFEQLLDERAAFGLHKGINVLIEHADFLLETKTPMNLFSDQTIGSITNTIEPTAAAKNVVQFLGFHMRILVGRADHEILDVFYKEVGMRLFDSLTRYIKSHKFSVDGGLKLLSDCNLYYEFIHSLHQSSLLPYFKTLKEIAHLFIIDGKNAEEIGKLATDTSRFSSAFHTEEVYEILHSRIDWLNIKYEVDKVIHGLACCIM 0F92F9824F579D6C pop1_schpo WD repeat-containing protein pop1 WD repeat-containing protein ste16 pop1 SPBC1718.01 SPBC2G2.18 ste16 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNEKKKDSLSVLDSNEFFGETTMVSPSIDVSSSPRPNVERFSPCSTKKDLLEGNNIMTRIPEELSRVSLQFDSKGSQQSMIFTNNRCLSDKENLENLQNLLYLHCDLNRPHLSCELPSEHREKCLKRRNSSLSSNLHANKRFLFNSQSDGNKKNETFPSTNYSNVFYPNNCDSKEVASETTFSLDAPNNSVNYSYFSPNLLGNDSKTRQSFPPHSSSSSHNSLHEPVIYDFSSENPSIHPSNHLSSQKNAVLKLAQLISSFEKLPESVRQYLLFHLLSRCGKHAVQNIHKILLPIFQKNFLTGFPAEITNLVLTHLDAPSLCAVSQVSHHWYKLVSSNEELWKSLFLKDGFFWDSIDSKIRTMCLEQSLSACAIMKRVYFRHFNLRERWLHAPEKIKRCSFPIHGVRLITKLQFDDDKIIVSTCSPRINIYDTKTGVLIRSLEEHEGDVWTFEYVGDTLVTGSTDRTVRVWDLRTGECKQVFYGHTSTIRCIKIVQGNQSTTDTDDVEKENRPASNDANSMPPYIISSSRDCTIRLWSLPCLDDPPFVNVNENPDQNNDFTSATTNPFYIRTLRGHTDSVREVACLGDLIVSASYDGTLRVWKASTGVCLHVLRGHVGRVYSVTINPSRQQCISAGTDAKIRIWNLESGELLQTLHGHSNLVSQVTFNQNILVSASAPPDTSLRVWDLNTGSCRDILKCPLGHIFFQHDESKVVSGSHSTLQLWDIRSGKLVRDLLTDLDIIWQVAYNENVCVAAVLRNNRFWIEVLEFGSTKSS B06EDBA46553EEC1 pof13_schpo F-box protein pof13 pof13 SPBC1271.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MRPTHWSSNQCEVDFTAEALTTLSLSNRNHEEDPIQPVLKNSNLFLLNRDIWSLIINYLDAFDILRLMHSSRQFYYWLRKSAVDECCFNNNFLNLQPYQRTVPVASDLEWATEVDLYGNPPILKLQLRDSFVWSMLAKFQGLQTIALDGTGVTISSVTNILLNIPTVKTLSIRWCVGVCSLSLIEFLQNSKSRTFSLENLYVLGVKGLELLKPVLLDGSEDDTLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNACKIAGQETELADLFSLQKVPACIYCLREWKKPICRYCIDLRSCLVCDSFVCPSCISLDFDLQIQAFARQHRVISTLGVVYPEREDSCFHKIKAAQWHQISPRSLLFQFQEQNHIHHKKIRRKLLAAGWKWPQSQI D3F7C905B584C1E6 pof10_schpo F-box/WD repeat-containing protein pof10 pof10 sbp2 SPBC1703.06 Skp1-binding protein 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKSEPTSLDFTSSNLRRMNRDHSSNNTNRTVLNLPKEILIIIFSFLDPRSLLSAQCTCKYWKKLLSDDLSWRTAFFHHFAGDQSQIFSPLGNGTWRQEYLLRSTITRAYEKGKGQTVQYDCRVGQLTNLYYDFSSGRLYSGNWLTGTISVSDPTTGKVERSLLHASTDGSFTHGLSTMTLGKQIFGFGFMDGRVGVILMSRQAETPRKFRYCLDSHADSVTCIDALTGDLPPTGEIGMVTGSDDGSVHCWDVKTGVSLQSFQFRSSQILSLCFRPKYKMLLVDTFNYELNSYQLYLIPGYARSRKNEQPILLSSRKCVLTDEEEPPCLMTADCCAGVAFLSRGAPKNCICRVSFKEFLEKNDNVGVQTSSIPLNGKPTSISLDTNDRVLSKSTPGRGARLLAVGDENGLVYVVNTRTEDPNKAILRTITAYSNFPITDIYLNEVAMVVGSASGYCGVYDTVTGNFLKKIASARNAARREPINCILLDSNPLSLKGVITMSKHVKSWSYTIPKPFVNKRSKVLPLRPSVTHDNLSKSSDYSKNEVEREIMLGLDQIAQERREKMEARQKFEQHFGEGLVGLSEEEIIAYVTMLSQEEEAKRMVQLSMDVDKIEEDFKENDEQATSSLNALSSNHEPPQEQANVAELNEQEQIELAMRLSLMEM 44061C20A61F602C skp1-cul1 1 9 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-fbh1 1 6 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. In cases where the C-terminus could not be tagged due to loss of protein function, GFP (green fluorescence protein) was used to tag the N-terminus of the protein under the thiamine repressible nmt promoter (e.g. GFP-Pof6 and GFP-Fdh1). skp1-pop1 1 17 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pop2 1 4 unspecified role unspecified role bait bait in vitro In vitro 3 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof1 1 4 unspecified role unspecified role bait bait Q9Y709:p.Ile110Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I T Wed May 02 14:50:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile110thr' Tue Jun 30 18:59:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile110Thr' in vitro In vitro 14 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. There was ~30% reduction in binding of pof1 with the temperature-sensitive skp1 mutant. skp1-pof2 1 4 unspecified role unspecified role bait bait in vitro In vitro 8 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof3 1 2 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait Q9Y709:p.Ile110Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I T Wed May 02 18:34:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile110thr' Tue Jun 30 17:21:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile110Thr' in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. There was ~50% reduction in the binding of pof3 with the temperature-sensitive skp1 mutant. skp1-pof4 1 12 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof5 1 11 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof6 1 4 unspecified role unspecified role bait bait in vitro In vitro 16 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. In cases where the C-terminus could not be tagged due to loss of protein function, GFP (green fluorescence protein) was used to tag the N-terminus of the protein under the thiamine repressible nmt promoter (e.g. GFP-Pof6 and GFP-Fdh1). skp1-pof7 1 15 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof8 1 4 unspecified role unspecified role bait bait in vitro In vitro 13 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof9 1 4 unspecified role unspecified role bait bait in vitro In vitro 7 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof10 1 19 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait Q9Y709:p.Ile110Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I T Wed May 02 16:23:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile110thr' Tue Jun 30 16:47:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile110Thr' in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. There was ~30% reduction in the binding of pof10 with the temperature-sensitive skp1 mutant. skp1-pof11 1 10 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 4 unspecified role unspecified role bait bait in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof12 1 4 unspecified role unspecified role bait bait in vitro In vitro 5 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody. skp1-pof13p 1 4 unspecified role unspecified role bait bait in vitro In vitro 18 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association Fig 5 In order to verify this and to examine the effects of mutation on Skp1 interactions we carried out a binding analysis of mutant Skp1tsA7 with F-box proteins and Pcu1 by immunoprecipitation. Each F-box protein was tagged with a myc epitope at its C-terminus. Immunoprecipitations were carried out using a polyclonal anti-Skp1 antibody.