UniProt UniProt http://www.uniprot.org SIX1 mutations cause branchio-oto-renal syndrome by disruption of EYA1-SIX1-DNA complexes. SIX1 mutations cause branchio-oto-renal syndrome by disruption of EYA1-SIX1-DNA complexes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Ruf RG., Xu PX., Silvius D., Otto EA., Beekmann F., Muerb UT., Kumar S., Neuhaus TJ., Kemper MJ., Raymond RM., Brophy PD., Berkman J., Gattas M., Hyland V., Ruf EM., Schwartz C., Chang EH., Smith RJ., Stratakis CA., Weil D., Petit C., Hildebrandt F. Fig 3 gel-mobility shift assay for six1 not included. Six1 binds DNA. fhilde@umich.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ruf RG., Xu PX., Silvius D., Otto EA., Beekmann F., Muerb UT., Kumar S., Neuhaus TJ., Kemper MJ., Raymond RM., Brophy PD., Berkman J., Gattas M., Hyland V., Ruf EM., Schwartz C., Chang EH., Smith RJ., Stratakis CA., Weil D., Petit C., Hildebrandt F. Fig 3 gel-mobility shift assay for six1 not included. Six1 binds DNA. fhilde@umich.edu Accepted 2007-AUG-25 by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation eya1_mouse Eyes absent homolog 1 Eya1 protein protein mouse Mus musculus Mouse MEMQDLTSPHSRLSGSSESPSGPKLDSSHINSTSMTPNGTEVKTEPMSSSEIASTAADGSLDSFSGSALGSSSFSPRPAHPFSPPQIYPSKSYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTESGLSQSQSPGQTGFLSYGTSFGTPQPGQAPYSYQMQGSSFTTSSGLYSGNNSLTNSSGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYSTIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL D31F71852FBDC76C six1_mouse Homeobox protein SIX1 Six1 Sine oculis homeobox homolog 1 protein protein mouse Mus musculus Mouse MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSHGLQAHQHQLQDSLLGPLTSSLVDLGS 4A6F88000FB9F8EB six1-eya1-1 1 2 unspecified role unspecified role prey prey eya1_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait Q62231:p.Arg110Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R W Wed May 02 15:48:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg110trp' Tue Jun 30 18:09:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg110Trp' Q62231:p.Tyr129Cys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 19:35:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr129cys' Tue Jun 30 17:59:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr129Cys' Q62231:p.Glu133del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E . Wed May 02 17:03:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu133del' Tue Jun 30 16:37:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu133del' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3A