UniProt UniProt http://www.uniprot.org Myristoylated Naked2 escorts transforming growth factor alpha to the basolateral plasma membrane of polarized epithelial cells. Myristoylated Naked2 escorts transforming growth factor alpha to the basolateral plasma membrane of polarized epithelial cells. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Li C., Franklin JL., Graves-Deal R., Jerome WG., Cao Z., Coffey RJ. robert.coffey@vanderbilt.edu 13-Nov-2007: Contacted by JYOTI. A cDNA library from HCA-7 cells grown as a uniform polarizing monolayer was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li C., Franklin JL., Graves-Deal R., Jerome WG., Cao Z., Coffey RJ. robert.coffey@vanderbilt.edu Accepted 2007-NOV-8 by JYOTI. 13-Nov-2007: Contacted by JYOTI. A cDNA library from HCA-7 cells grown as a uniform polarizing monolayer was used. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation Myristoylated Naked2 escorts transforming growth factor alpha to the basolateral plasma membrane of polarized epithelial cells. Myristoylated Naked2 escorts transforming growth factor alpha to the basolateral plasma membrane of polarized epithelial cells. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 imex curation Li C., Franklin JL., Graves-Deal R., Jerome WG., Cao Z., Coffey RJ. robert.coffey@vanderbilt.edu 13-Nov-2007: Contacted by JYOTI. A cDNA library from HCA-7 cells grown as a uniform polarizing monolayer was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li C., Franklin JL., Graves-Deal R., Jerome WG., Cao Z., Coffey RJ. robert.coffey@vanderbilt.edu Accepted 2007-NOV-8 by JYOTI. A cDNA library from HCA-7 cells grown as a uniform polarizing monolayer was used. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation nkd2_human Protein naked cuticle homolog 2 NKD2 protein protein human Homo sapiens Human MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDENTERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQVLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAVLPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS DIP protein Q969F2 original sequence version: 65 F27E708F9FAD1F2A tgfa_human Protransforming growth factor alpha TGFA protein protein human Homo sapiens Human MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV DIP protein P01135 original sequence version: 117 D692184F9353DE47 tgfa-nkd2-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association tgfa-nkd2-2 1 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P01135:p.[Leu146Ala;Leu147Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:22:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu146ala,leu147ala' Tue Jun 30 16:56:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu146Ala;Leu147Ala]' region binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1B