IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. Development (0950-1991) 2003 Esch JJ., Chen M., Sanders M., Hillestad M., Ndkium S., Idelkope B., Neizer J., Marks MD. dmarks@biosci.cbs.umn.edu orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Esch JJ., Chen M., Sanders M., Hillestad M., Ndkium S., Idelkope B., Neizer J., Marks MD. dmarks@biosci.cbs.umn.edu Accepted 2007-DEC-20 by ORCHARD. Development (0950-1991) 2003 orchard A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. Development (0950-1991) 2003 Esch JJ., Chen M., Sanders M., Hillestad M., Ndkium S., Idelkope B., Neizer J., Marks MD. dmarks@biosci.cbs.umn.edu orchard arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress confocal microscopy confocal microscopy predetermined predetermined participant predetermined Esch JJ., Chen M., Sanders M., Hillestad M., Ndkium S., Idelkope B., Neizer J., Marks MD. dmarks@biosci.cbs.umn.edu Accepted 2007-DEC-20 by ORCHARD. Development (0950-1991) 2003 orchard ttg1_arath Protein TRANSPARENT TESTA GLABRA 1 TTG1 At5g24520 T31K7.8 K18P6_4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSSGHRIAVGSFLEDYNNRIDILSFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSSTVEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWDIEKSVVETQLIAHDKEVHDIAWGEARVFASVSADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSNKVVILDIRSPTMPVAELERHQASVNAIAWAPQSCKHICSGGDDTQALIWELPTVAGPNGIDPMSVYSAGSEINQLQWSSSQPDWIGIAFANKMQLLRV B247738AE41FEE38 try_arath Transcription factor TRY TRY MFH8.14 Protein TRIPTYCHON At5g53200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNTDRRRRRKQHKIALHDSEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQPEEIERYWIMRNSEGFADKRRQLHSSSHKHTKPHRPRFSIYPS 2957DF51D3F86D86 gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL DIP protein P27900 original sequence version: 134 822A8646F446F6B9 gl3_arath Transcription factor GLABRA 3 Basic helix-loop-helix protein 1 Protein SHAPESHIFTER At5g41315 GL3 BHLH1 MYC6 SST MYC6.2 EN31 Transcription factor EN 31 bHLH transcription factor bHLH001 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGQNRTTVPENLKKHLAVSVRNIQWSYGIFWSVSASQSGVLEWGDGYYNGDIKTRKTIQASEIKADQLGLRRSEQLSELYESLSVAESSSSGVAAGSQVTRRASAAALSPEDLADTEWYYLVCMSFVFNIGEGMPGRTFANGEPIWLCNAHTADSKVFSRSLLAKSAAVKTVVCFPFLGGVVEIGTTEHITEDMNVIQCVKTSFLEAPDPYATILPARSDYHIDNVLDPQQILGDEIYAPMFSTEPFPTASPSRTTNGFDQEHEQVADDHDSFMTERITGGASQVQSWQLMDDELSNCVHQSLNSSDCVSQTFVEGAAGRVAYGARKSRVQRLGQIQEQQRNVKTLSFDPRNDDVHYQSVISTIFKTNHQLILGPQFRNCDKQSSFTRWKKSSSSSSGTATVTAPSQGMLKKIIFDVPRVHQKEKLMLDSPEARDETGNHAVLEKKRREKLNERFMTLRKIIPSINKIDKVSILDDTIEYLQELERRVQELESCRESTDTETRGTMTMKRKKPCDAGERTSANCANNETGNGKKVSVNNVGEAEPADTGFTGLTDNLRIGSFGNEVVIELRCAWREGVLLEIMDVISDLHLDSHSVQSSTGDGLLCLTVNCKHKGSKIATPGMIKEALQRVAWIC 5225EF0E9745CDB7 gl1-gl3-3 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey Q9FN69:p.Leu78Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L F Wed May 02 16:09:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78phe' Tue Jun 30 18:13:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Phe' physical association physical association 6 yeast containing either sst-AD or GL3-AD and GL1-BD, TRY-BD or TTG1-BD exhibited b-gal activity (Fig. 6A-C). However, there was a significant difference in activity level between the strains containing either sst-AD or GL3-AD. Yeast isolates containing GL1-BD and GL3-AD exhibited It was demonstrated that free TRY protein could inhibit the interaction between GL3 and GL1 proteins. TRY (Q8GV05) protein ttg1-gl3-4 1 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey Q9FN69:p.Leu78Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L F Wed May 02 16:43:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78phe' Tue Jun 30 20:03:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Phe' physical association physical association 6 yeast containing either sst-AD or GL3-AD and GL1-BD, TRY-BD or TTG1-BD exhibited b-gal activity (Fig. 6A-C). However, there was a significant difference in activity level between the strains containing either sst-AD or GL3-AD. Yeast isolates containing GL1-BD and GL3-AD exhibited try-gl3-5 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 6 yeast containing either sst-AD or GL3-AD and GL1-BD, TRY-BD or TTG1-BD exhibited b-gal activity (Fig. 6A-C). However, there was a significant difference in activity level between the strains containing either sst-AD or GL3-AD. Yeast isolates containing GL1-BD and GL3-AD exhibited gl1-gl3-try 2 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 7 These results place TRY, GL3 and GL1 proteins in the trichome nuclei, where they could interact as observed in the yeast system. Proteins colocalised to the trichome nuclei