UniProt UniProt http://www.uniprot.org The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. Curr. Biol. (0960-9822) 2003 Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk 12-Oct-2007: Contacted by JYOTI. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Curr. Biol. (0960-9822) 2003 The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. Curr. Biol. (0960-9822) 2003 Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk 12-Oct-2007: Contacted by JYOTI. in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk Accepted 2007-OCT-24 by JYOTI. Curr. Biol. (0960-9822) 2003 The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. Curr. Biol. (0960-9822) 2003 Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk 12-Oct-2007: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Curr. Biol. (0960-9822) 2003 The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. Curr. Biol. (0960-9822) 2003 Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk 12-Oct-2007: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Curr. Biol. (0960-9822) 2003 The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus. Curr. Biol. (0960-9822) 2003 Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk 12-Oct-2007: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Panic B., Whyte JR., Munro S. GST fusion proteins have been loaded with either GDP or nonhydrolyzable GTP-analog GTP-gamma-S. Extracts of yeast expressing VPS53 fusion protein have been used. A yeast strain lacking VSP52 was used, leading to an overexpression of VSP53 due to GARP complex disassembly. sean@mcr-lmb.cam.ac.uk Accepted 2007-OCT-24 by JYOTI. 12-Oct-2007: Contacted by JYOTI. Curr. Biol. (0960-9822) 2003 arl1_yeast ADP-ribosylation factor-like protein 1 ARL1 Arf-like GTPase 1 ARF3 YBR1216 YBR164C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQL 84D0E1F79EC21E38 vps53_yeast Vacuolar protein sorting-associated protein 53 J1258 YJL029C VPS53 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEGTVDYDPLEDITNILFSKESLNNIDELISITRSYKKQLQEDILKEENELKEHPKNSAEIEASLRKVFQDFKETQDVSASTELTISNLTEGISYLDIAKKNLTHSLTLFQNLKILTDSYIQCNELLSQGSFKKMVSPYKIMCSLAENTFISYKSLDEINYLLSSISRLKGDTLSKIKQNYNALFSGGNISEHDTALTMELREGACELLDCDTSTRAQMIDWCLDKLLFEMKEIFRVDDEAGSLENLSRRYIYFKKILNNFNSKFADYFLKDWEMAVRLTTTFYHITHKDLQTLLKREFKDKNPSIDLFMTALQSTLDFEKYIDVRFSKKIKEPKLSSCFEPYLTLWVSHQNQMMEKKFLSYMSEPKYPSNETESLVLPSSADLFRTYRSVLTQTLELIDNNANDSILTSLANFFSRWLQTYSQKILLPLLLPDNIEVQDKLEAAKYTVLLINTADYCATTIDQLEDKLSEFSGNREKLANSFTKTKNIYDDLLAKGTSFLLNRVIPLDLNFVWREFINNDWSNAAIEDYSRYMVTLKSVLKMPALTDASIKQQQEQPSTLAFILSQFNRDVYKWNFLDKVIDIITTNFVSNTIRLLQPVPPFSLAGSKRKFETRTVVNIGEQLLLDLELLKEIFHTLPESVSNDSDLRENTSYKRVKRHADNNIDQLLKFIKLLMAPLDSADDYYETYSKLTNNNPDSAVWSFVLALKGIPWDLALWKKLWSAYNLETDDTDEGSRPDSNRDLFIFKWDKVLLGQFENNLARMQDPNWSKFVRQDLKISPPVMKRIVSTPQIQQQKEEQKKQSLSVKDFVSHSRFFNRGT C75F19FA57157481 vps54_yeast Vacuolar protein sorting-associated protein 54 VPS54 CGP1 CPF1 genetically-interacting protein 1 Temperature-sensitive clathrin synthetic mutation protein 3 LUV1 RKI1 TCS3 YDR027C PZF889 YD9813.05C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSISETPHNKSQGLQKAAGRPKIVVPEGSPSRNSDSGSFTIEGDTSLNDDLLSISGSVTPRARRSSRLSLDSITPRRSFDSRTLSVANSRSFGFENETHSGSMDFSPLGNNSIYEIVMNTRRKNWLNYPTVADIPQVSLSKNDLDDHWKTHVIEYVKNIKSDYQIFQSTNNIRNMNQMEQLKELREGENMHEESFEANLRQGDAELINSIPDFYFSDKFQLDNPRTFHKVLDAIDLFLTKLDMKRQAERDEAFSELRDRLNDFLDIVETLLVTEISKSSHKFFHALSEVDNIQKRALDTMSELKELAQNIKTIDAENIRKKISHLEMIFKRKNVEKLEQGLLQAKLVLNKTDECKSMYEENKLDNCLELIKSIDYLIKGDDSINEDVQSWTRCWPYKLSNLRTIPALSATREFLTNMKIEIGGKFSLQLSILLIDDLRSFCKSIKPKETLHRIQTGSNDKKQTIFTDNFSSKITELIVRLNRCEELTSAFDLYREKSITELKSIIKIYLPTENAHADNNHDEKHLNNGSTSGSKLSRLIKEQTPAEFQSMLVNIFTHALEALRRLYGHQKLLLDISLNELASVKSPNENQHNMITQLDIRTGINEIIRIIQLRTGKIIAVRRELNLSLRYDYFLKFYAICVIFIQECEVLSGEFLTKYLSNVLASQIKHYANAQSSKNYRNIKKKIDAEEWIPYIVDSSIQSDVNDIVSSIDIDPLSWTTILDMVGGSHDCENGRSEDKEKDEGNETYQGHRKSVVVGDKTFVASSSLLATIEVIKELMVLSINLPSIYLSNFEKLCYDALQYYNSSAMASVTQPGNSLLKTGRNLSIMGESLDCLAEFVIIVQRFYQRLSNSNRDFEPFDASHYTTLLGQFQASSNKIYMANAPPPPV 67E930C34E8CC5AA imh1_yeast Golgin IMH1 Integrins and myosins homology protein 1 YLR309C IMH1 SYS3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFKQLSQIGKNLTDELAKGLADDMSPTPSEQQIEDDKSGLPKEIQAKLRKFEKYEQKYPLLLSAYKNEKLKSEKLEAVEKILAENTPISNIDDAVDTLPAFFQDLNNKNNLLNDEIKRLTKQNSEIPESASSETLKDKEEEFLKKEQNYKNDIDDLKKKMEALNIELDTVQKEKNDTVSGLREKIVALENILKEEREAKKQKEEVSISELKEELAIKNHSLEDSRMKITELEQNLSSKSTIMEEKSSELAELNITLKEKERKLSELEKKMKELPKAISHQNVGNNNRRKKNRNKGKKNKGGITTGDISEEETVDNSINTEEYDKLKENLQELQEKYKDCEDWKQKYEDIEAELKDAKELENSQLEKSAKELETLNTELIDTKKSLKEKNSELEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLRHKNATMIEAYEAKNTELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEISQLTYEKSNITKELTSLRTSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQLRKDHAKISNRLDLLKKENETLHNDIAKNSNSYEEYLKENGKLSERLNILQEKYNTLQNVKSNSNEHIDSIKRQCEELNVKLKESTKKILSLEDELNEYANIVQDKTREANTLRRLVSDSQTDDSSKQKELENKLAYLTDEKNKLEAELDLQTSRKATELQEWKHTVTELKSEIHALKLREEGLKSEVDALKHVNNDIKRKTQATSDDSDQLEQITSNLKLSLSKADEKNFELQSANEKLLNLNNELNKKFDRLLKNYRSLSSQLNALKERQYSDKSGRVSRSGSIGTLANANIDSSPANNSNPTKLEKIRSSSSLELDSEKNEKIAYIKNVLLGFLEHKEQRNQLLPVISMLLQLDSTDEKRLVMSLK 090BD9AA5702C01D 090BD9AA5702C01D slo1_yeast SCOCO-like protein 1 SLO1 YER180C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAENISTGSPTGKQPSSEVNLGEREAGTKNERMMRQTKLLKDTLDLLWNKTLEQQEVCEQLKQENDYLEDYIGNLMRSSNVLEK 5A1CF70DB5BC42F2 arl1-imh1-1 2 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey physical association physical association By GTP. 2A arl1-imh1-2 4 9 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tyr780ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:25:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr870ala' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1393714]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 822-822, sequence length 183 [EBI-1393714]822-911 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association By GTP. 2B, C and D arl3-slo1-1 4 10 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q3E784:p.Tyr72Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:21:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr72ala' Tue Jun 30 17:01:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr72Ala' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3C and D Interaction was independent of ARL1 nucleotide state (GDP / GTP). arl1-vps54-3 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 4A By GTP. arl1-vps53-1 4 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4B By GTP. arl1-vps54-1 4 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4B By GTP. arl1-vps53-2 5 7 unspecified role unspecified role prey prey region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association The interaction is independent of GDP and GTP. 4C arl1-vps54-2 3 6 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4D