UniProt UniProt http://www.uniprot.org Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Mol. Biol. Cell (1059-1524) 2003 Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis piper@usal.es 01-Feb-2008: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of Protein Q8CIN4 taken from PMID: 9659915 Source of Protein Rtkn Q8C6B2 taken from PMID: 8662891 piper@usal.es Accepted 2008-FEB-3 by CDEROW. 01-Feb-2008: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2003 Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Mol. Biol. Cell (1059-1524) 2003 Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis piper@usal.es 01-Feb-2008: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis piper@usal.es Accepted 2008-FEB-3 by CDEROW. 01-Feb-2008: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2003 Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Gef1p, a new guanine nucleotide exchange factor for Cdc42p, regulates polarity in Schizosaccharomyces pombe. Mol. Biol. Cell (1059-1524) 2003 Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis piper@usal.es 01-Feb-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Coll PM., Trillo Y., Ametzazurra A., Perez P. Apoptosis - Interactions involving proteins with a function related to apoptosis piper@usal.es Accepted 2008-FEB-3 by CDEROW. 01-Feb-2008: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2003 pak2_mouse Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK Pak2 protein protein mouse Mus musculus Mouse MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAPPVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR DIP protein Q8CIN4 original sequence version: 83 D8BDA7B193D41B1B rho1_schpo GTP-binding protein rho1 rho1 SPAC1F7.04 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MATELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGAYKYLECSAKTNEGVREVFESATRAAMLKHKPKVKPSSGTKKKKRCILL 21B625E0B9098CB1 gef1_schpo Rho guanine nucleotide exchange factor gef1 gef1 SPAC24H6.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast METLKADLSDMSDSPEYFETLANRDLPRLPGTSKLHRAACIKRKSINLSLPSNSYSLSYRQSDDTDGDVSESQSEYRLSSGRRSRASFARALQDPQTPNTPPVSSQHRRFFSEGSFNLPNSNMSHSLNGDSTASNSSTLTPNRIYGDRNRQDYAQSSRYTLPSLPSSPSYNCPTTLRKIHTNTSSNGTSRRVSGLGSFMAQNSSETSSNRTSAYLPGSSTDEQEKRSSVTLASMPSSHSSTASLLSPLDTTSFSTKLDSTILALETDESLSRTISYATTSLPSTPGKRLSKESLAMSEASSINPEYKRIKKRANLIKELVTTEAAYLNDLIAIQQSYGLRVKECSALNPVDAQTVFGDIESLLTFTVEFHSRLYQAGEGSWRVNLDTQLIDPLPCNLGLIFLESLSEIGQIYTGYCNRQDSVFKIITKWREKPATASWIMEGDKIVQKYTNAWDLGSLIIKPLQRLLKYPLLLQKIIDVTPESSSERPDLVLSYQLLQELISGINQKQKPSHKRGSLSASHKRDAAWSLLYKATSNKSRPTTTSTELKTDARLNFQRQVLQDFRQRFAILKALHATLETWYVTVHRGFSVFEKVLAELEGLSALEPEDKPVDTWRKYHLLAHMMTANLPSQIQTSLNSSILNPITNILRVIQKVIQFIISAEFVIPAQKLEAISTLVEKEFHSVVYHFIGIQRSLYENYAQGFLFLIPQDMRDSILEETQDYAELVRAFEPMHYDDEVLLEELMKSVSLAARV 5740A1AE0D67F207 cdc42_schpo Cell division control protein 42 homolog CDC42Sp cdc42 SPAC110.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPTIKCVVVGDGAVGKTCLLISYTTNKFPSDYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLRDDPSVQQKLARQHQHPLTHEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALDPPVPHKKKSKCLVL EDBC8DA3F3E89301 q8c6b2-2 Rhotekin Rtkn protein protein mouse Mus musculus Mouse MQDRLRILEDLNMLYIRQMALSLEDTELQRKLDHEIRMRDGACKLLAACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLEKTGRRPSDSVQPAQHSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQIGEQIQDTEMVLVDRTLTDISFQNNVLFAEAEPDFELRLELYGACVEEEGALAGAPKRLATKLSSSLGRSSGKRVRASLDSAGASGNSPVLLPTPAVGGPRFHLLAHTTLTLEEVQDGFRTHDLTLTSHEENPAWLPLYGSVCCRLAAQPLCMIQPTASGALRVQQAGELQNGTLVHGVLKGTNLFCYWRSEDADTGQEPLFTIVINKETRVRAGELEQAPEWPFTLSISNKYGDDEVTNTLQLESREALQNWMEALWQLFFDMSQWRHCCDEVMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILAQREGTRLEPSPPWLAMFTDQPALPSSCSPASVAPVPTWMQPLPWGRPRTFSLDAAPADHSLGPSRSVAPLPPQRSPKSRGFYSKSQLGPWLQSPV EA3D925FFF0FB85B cdc42-gef1-1 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q01112:p.Asp118Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:03:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp118ala' Tue Jun 30 16:26:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp118Ala' Q01112:p.Thr17Asn mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 14:54:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 17:28:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' physical association physical association Table 2 Gef1p specifically interacted with the GDP-bound form of Cdc42p (Cdc42D118A or Cdc42T17N) cdc42-gef1-2 2 6 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q01112:p.Thr17Asn mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:29:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 17:05:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' physical association physical association Fig 1A the band corresponding to HA-Gef1p was detected in the GST-Cdc42p immunoprecipitates and was stronger in GST-Cdc42T17N immunoprecipitates. rtkn-rho1-1 1 5 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1B pak2-cdc42-1 1 4 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig 1B Interaction is stimulated by expression of gef1.