IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction with PCNA is essential for yeast DNA polymerase eta function. Interaction with PCNA is essential for yeast DNA polymerase eta function. Mol. Cell (1097-2765) 2001 imex curation Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. Proteins purified prior to gel filtration. Complex size determined by molecular weight. lprakash@scms.utmb.edu 09-MAR-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro dna dna pol assay dna directed dna polymerase assay dna dna pol assay predetermined predetermined participant predetermined Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. lprakash@scms.utmb.edu Accepted 2007-APR-1 by JYOTI. 09-MAR-2007: Contacted by JYOTI. Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Interaction with PCNA is essential for yeast DNA polymerase eta function. Interaction with PCNA is essential for yeast DNA polymerase eta function. Mol. Cell (1097-2765) 2001 imex curation Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. Proteins purified prior to gel filtration. Complex size determined by molecular weight. lprakash@scms.utmb.edu 09-MAR-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. Proteins purified prior to gel filtration. Complex size determined by molecular weight. lprakash@scms.utmb.edu Accepted 2007-APR-1 by JYOTI. 09-MAR-2007: Contacted by JYOTI. Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Interaction with PCNA is essential for yeast DNA polymerase eta function. Interaction with PCNA is essential for yeast DNA polymerase eta function. Mol. Cell (1097-2765) 2001 imex curation Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. Proteins purified prior to gel filtration. Complex size determined by molecular weight. lprakash@scms.utmb.edu 09-MAR-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. lprakash@scms.utmb.edu Accepted 2007-APR-1 by JYOTI. 09-MAR-2007: Contacted by JYOTI. Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation m13 Phage M13 genome dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid bpm13 Enterobacteria phage M13 Bacteriophage M13 pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC 9B56C5851621DDDC polh_yeast DNA polymerase eta RAD30 DBH1 YDR419W Radiation-sensitive protein 30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKLECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLFSRKRPNSQHTATPQKKQVTSSKNILSFFTRKK CFB1A9FBC8AFE39B CFB1A9FBC8AFE39B pcna-7 2 5 unspecified role unspecified role neutral component neutral component physical association physical association 2A In I, PCNA is alone (5 μg, not, vert, similar0.2 nmol); in II, the mixture of Polη (5 μg, not, vert, similar0.05 nmol) and PCNA (5 μg, not, vert, similar0.2 nmol) were gel filtered. pcna-rad30-1 2 6 unspecified role unspecified role neutral component neutral component c-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q04049:p.Phe627_Phe628delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain FF AA Thu Jul 07 12:07:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was phe627ala_phe628ala Fri Jul 22 10:50:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe627ala,phe628ala' Wed May 02 19:33:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_phe627-628ala_ala' Tue Jun 30 18:16:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe627_Phe628delinsAlaAla' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role neutral component neutral component yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 2A In I, PCNA is alone (5 μg, not, vert, similar0.2 nmol); in II, the mixture of Polη (5 μg, not, vert, similar0.05 nmol) and PCNA (5 μg, not, vert, similar0.2 nmol) were gel filtered. pcna-rad30-2 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q04049:p.Phe627_Phe628delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain FF AA Thu Jul 07 12:16:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was phe627ala_phe628ala Fri Jul 22 11:10:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe627ala,phe628ala' Wed May 02 19:38:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_phe627-628ala_ala' Tue Jun 30 16:51:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe627_Phe628delinsAlaAla' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Table 1 We used the yeast two-hybrid system to test for Polη interaction with PCNA in vivo pcna-rad30-3 1 6 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 enzyme target enzyme target substrate substrate unspecified role unspecified role dna elongation dna strand elongation DNA replication elongation dna elongation 2B To assess the functional significance of Polη interaction with PCNA, we examined whether PCNA could stimulate DNA synthesis by Polη in the presence of RFC and RPA By PCNA (P15873), Replication Factor Complex and RPA (P22336) at 150mM NaCl.