IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transcription of chromosomal rRNA genes by both RNA polymerase I and II in yeast uaf30 mutants lacking the 30 kDa subunit of transcription factor UAF. Transcription of chromosomal rRNA genes by both RNA polymerase I and II in yeast uaf30 mutants lacking the 30 kDa subunit of transcription factor UAF. EMBO J. (0261-4189) 2001 Siddiqi IN., Dodd JA., Vu L., Eliason K., Oakes ML., Keener J., Moore R., Young MK., Nomura M. Cell extract purified by pulldown on a Nickel column, heparin sulphate, anti-Ha affinity chromatography, followed by a further heparin sulphate column. p30 component identified by mass spectrometry. Components previously identified in EBI-13961112. mnomura@uci.edu davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Siddiqi IN., Dodd JA., Vu L., Eliason K., Oakes ML., Keener J., Moore R., Young MK., Nomura M. Cell extract purified by pulldown on a Nickel column, heparin sulphate, anti-Ha affinity chromatography, followed by a further heparin sulphate column. p30 component identified by mass spectrometry. Components previously identified in EBI-13961112. mnomura@uci.edu Accepted 2007-OCT-19 by DAVET. EMBO J. (0261-4189) 2001 davet h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 69B7D1F89E62DE41 rrn9_yeast RNA polymerase I-specific transcription initiation factor RRN9 RRN9 YM8156.12C YMR270C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLDEESQIETQIDAPIEDIIRGSELTTTTADKETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQFVKTQIKDNWTSWPNPNTIIDPSVDKLYEDIPEGIANVSVQPGEISNRALMHASDMMRVELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHDKIAKENEFDVRQDKHSNNIRANQIDDEPMQANRRIKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIPEKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFIPVEKLLKDKRLTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIELPNGNI 4C1E261C6FCAF850 rrn5_yeast RNA polymerase I-specific transcription initiation factor RRN5 RRN5 L3165 L9606.3 YLR141W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEHQQLRKYVELYNKEVEEFYNGAASGRPAEFHPSKVHVKSIHEKAGTANAGVEISSVGVDWDSEEKNTFFWCLSRYSIHRVDEWRSLLPRKSAMEILGYYRLLRRASASARSRKAGDDGAPIAYEMSAEWVALETKLSETVMAITEGAAEVADEEGHCEGLIDYESWKRRWVAIYSHSRIAEIRPLPRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSVSARAAESRGHKSLPTVVTRRQVERALCTEARSRDLHVLPRRIVLTLRKWELDYPREGKLFRTKEMAHLFLQSQLSRRDAPPVHQDENQENQENQENQEQDNTASEGESEAERDEIDEADLFRSALHENQLLKWLSK E3C25C1B1E336820 rrn10_yeast RNA polymerase I-specific transcription initiation factor RRN10 RRN10 YBL0426 YBL025W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDRNVYEACSNIIKEFGTHVVSADEVLAEKIDNAVPIPFKTREEIDADVEKDRNEGVFEGNIIPDIDLRVVHYYATQLCLNKYPHLINAFDETSLITLGLLIEKWVKDYLTSIQTEQGRQSKVIGKGPCEFISKHIDYRHAPGNI 970E552D55ECE41D 970E552D55ECE41D uaf30_yeast Upstream activation factor subunit UAF30 UAF30 YOR295W Upstream activation factor 30 KDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MAELNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERPRFERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDSETKGTHVEKKKGTVSKSPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKSTNMFEMHKILASHMTEPKKISDCPPLIQEVRRKEKPIVSDSEQSDTKGI C480D943D728021A h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A A6115FEB480AC67A rrn5-rrn9-2 1 5 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component c-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component association association Figs 1 and 2 UAF, a yeast RNA polymerase I transcription factor, contains Rrn5p, Rrn9p, Rrn10p, histones H3 and H4, and uncharacterized protein p30.