IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. Nucleic Acids Res. (0305-1048) 2000 imex curation Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. ktanaka@imcb.osaka-u.ac.jp HeLa cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. ktanaka@imcb.osaka-u.ac.jp Accepted 2007-DEC-2 by ORCHARD. HeLa cDNA library Nucleic Acids Res. (0305-1048) 2000 orchard Only protein-protein interactions imex curation A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. Nucleic Acids Res. (0305-1048) 2000 imex curation Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. ktanaka@imcb.osaka-u.ac.jp HeLa cDNA library orchard Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase autoradiography autoradiography Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. GTPase activity of XAB1 was detected after 15 minutes using thin layer chromatography. ktanaka@imcb.osaka-u.ac.jp Accepted 2007-DEC-2 by ORCHARD. HeLa cDNA library Nucleic Acids Res. (0305-1048) 2000 orchard Only protein-protein interactions imex curation A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA. Nucleic Acids Res. (0305-1048) 2000 imex curation Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. ktanaka@imcb.osaka-u.ac.jp HeLa cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nitta M., Saijo M., Kodo N., Matsuda T., Nakatsu Y., Tamai H., Tanaka K. Binding was measured by quantitative liquid beta-galactosidase assay of a Y2H system. ktanaka@imcb.osaka-u.ac.jp Accepted 2007-DEC-2 by ORCHARD. HeLa cDNA library Nucleic Acids Res. (0305-1048) 2000 orchard Only protein-protein interactions imex curation xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM DIP protein P23025 original sequence version: 75 DIP protein P23025 original sequence version: 116 F89F735219A8494B rpa34_human DNA-directed RNA polymerase I subunit RPA34 RNA polymerase I-associated factor PAF49 POLR1G A34.5 ASE1 Antisense to ERCC-1 protein CAST CD3-epsilon-associated protein CD3EAP DNA-directed RNA polymerase I subunit G PAF49 protein protein human Homo sapiens Human MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGKETFEPEDKTVKQEQINTEPLEDTVLSPTKKRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPKKKTKKEKQQDATVEPETEVVGPELPDDLEPQAAPTSTKKKKKKKERGHTVTEPIQPLEPELPGEGQPEARATPGSTKKRKKQSQESRMPETVPQEEMPGPPLNSESGEEAPTGRDKKRKQQQQQPV DIP protein O15446 original sequence version: 111 D460FB944412D393 gpn1_human GPN-loop GTPase 1 XAB1 XPA-binding protein 1 MBD2-interacting protein GPN1 MBDIN HUSSY-23 RNAPII-associated protein 4 RPAP4 protein protein human Homo sapiens Human MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK 9B96F452FAFE955C gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP DIP protein P07992 original sequence version: 109 DIP protein P07992 original sequence version: 69 DIP protein P07992 original sequence version: 162 6FCE3615732349E5 xpa-ercc1-1 1 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Two of them encoded known proteins that bind to XPA; 145 clones were ERCC1 and 45 clones were RPA34. xpa-rpa34 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Two of them encoded known proteins that bind to XPA; 145 clones were ERCC1 and 45 clones were RPA34. xpa-xab1-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Using the yeast two-hybrid system, we elucidated that XAB1 binds to the N-terminal region of XPA. xab1-xpa-1 3 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4 and Table 1 These results indicate that XAB1 interacts with the N-terminal region of XPA and that the five basic amino acid residues (residues 30-34) of XPA are important for the binding to XAB1. xab1-gtp-1 2 7 enzyme target enzyme target substrate substrate neutral component neutral component 6 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection gtpase reaction gtpase reaction 5C GTPase activity was detected in the fractions containing His-XAB1 GTP is labelled with 32P