IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A possible interaction of thioredoxin with VDUP1 in HeLa cells detected in a yeast two-hybrid system. A possible interaction of thioredoxin with VDUP1 in HeLa cells detected in a yeast two-hybrid system. Biochem. Biophys. Res. Commun. (0006-291X) 2000 Yamanaka H., Maehira F., Oshiro M., Asato T., Yanagawa Y., Takei H., Nakashima Y. hajime@nips.ac.jp 07-Sept-2007: Contacted by JYOTI. HeLa cell cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamanaka H., Maehira F., Oshiro M., Asato T., Yanagawa Y., Takei H., Nakashima Y. hajime@nips.ac.jp Accepted 2007-SEP-2 by JYOTI. 07-Sept-2007: Contacted by JYOTI. HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2000 A possible interaction of thioredoxin with VDUP1 in HeLa cells detected in a yeast two-hybrid system. A possible interaction of thioredoxin with VDUP1 in HeLa cells detected in a yeast two-hybrid system. Biochem. Biophys. Res. Commun. (0006-291X) 2000 Yamanaka H., Maehira F., Oshiro M., Asato T., Yanagawa Y., Takei H., Nakashima Y. hajime@nips.ac.jp 07-Sept-2007: Contacted by JYOTI. HeLa cell cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamanaka H., Maehira F., Oshiro M., Asato T., Yanagawa Y., Takei H., Nakashima Y. hajime@nips.ac.jp Accepted 2007-SEP-2 by JYOTI. 07-Sept-2007: Contacted by JYOTI. HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2000 txnip_human Thioredoxin-interacting protein TXNIP VDUP1 Vitamin D3 up-regulated protein 1 Thioredoxin-binding protein 2 protein protein human Homo sapiens Human MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ DIP protein Q9H3M7 original sequence version: null B0FE2D35D0B0735A thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 trx-txnip-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association In the present study, a possible interaction between hTrx and VDUP1 in HeLa cells was suggested using a yeast two-hybrid system. Figure 1 trx-txnip-2 1 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait P10599:p.[Cys32Ser;Cys35Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:43:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys32ser,cys35ser' Tue Jun 30 15:53:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys32Ser;Cys35Ser]' physical association physical association Binding of the proteins encoded by the three candidate clones containing the VDUP1 sequence with hTrx was confirmed by performing the secondary yeast two-hybrid assay on each clone Figures 2 & 3