IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Mol. Cell. Biol. (0270-7306) 2000 imex curation Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu 10-APR-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Mol. Cell. Biol. (0270-7306) 2000 imex curation Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu 10-APR-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. Mol. Cell. Biol. (0270-7306) 2000 imex curation Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu 10-APR-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation tim10_yeast Mitochondrial import inner membrane translocase subunit TIM10 MRS11 YHR005BC YHR005C-A TIM10 Mitochondrial intermembrane protein MRS11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF 70DD4764B944FF17 70DD4764B944FF17 tim54_yeast Mitochondrial import inner membrane translocase subunit TIM54 J1150 YJL054W TIM54 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSESGKPIAKPIRKPGYTNPALKALGIPALRLPSRNWMIFWSVLTVSIGGIAYDKYKQRQILSHATDLVKPLAEESMEVDKVPRKITVFIAPPPNDYLESSLKVWRRYVKPVLYYAGLDYELVQEDRQGIIRTNVANRIRELRKEILASTDGQPVKEPNQTVAKPSGSSTSKISSLLPFNKIIQDPAEEDDSFDPEIGKKFKENFDWRNVIGIFYTMPKPKHIISEDALTKDPILSGGVICLGRGAYKEYIAGIHEGLLGPIEKTEKTGSTEPKMTGVVEANQIESKVSESGATELVDAEKETALEEAKVQDDLKVDEENSSEDSQKFLKPFISSDQYPDLQIASELQTPNGEFIRNPNTNIPLLINQPLLVIPIPNLIGFTTIPRRIHRFYQKRFYVEDVCSSVVNCVRQTRIRPFDIAKDIDLAKDEEKDWPQNWVKQGKEKNSEWTQELVCDPRITKHMFVYEKPPKEEPESDI 0E682BB4035E3A4C tim18_yeast Mitochondrial import inner membrane translocase subunit TIM18 TIM18 YOR297C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLLFPGLKPVLNASTVIVNPVRAVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEFSQFKDSYQKDYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDYIPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLWNENDDHLYIFGRN FE5DBEF3E3446CF7 FE5DBEF3E3446CF7 tim22_yeast Mitochondrial import inner membrane translocase subunit TIM22 D0884 YDL217C TIM22 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFKE 3C94DBF31F413968 3C94DBF31F413968 tim12_yeast Mitochondrial import inner membrane translocase subunit TIM12 TIM12 Mitochondrial regulator of splicing 5 MRS5 YBR0812 YBR091C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK 2C4B7DEE9695866D 2C4B7DEE9695866D tim54-tim18-1 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association In addition to Tim10p and Tim22p, a band of ~18 kDa was seen that was absent from the control precipitates with nonimmune serum 1 tim54-tim18-2 3 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association With mitochondria from the strain expressing HA-tagged Tim18p, the tagged Tim18p comigrated with Tim54p and Tim22p (Tim18pHA in Fig. 4A). 4A Molecular weight of complex = 300kDa tim54-tim18-3 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey association association and immunoblotting. HA-tagged Tim18p coimmunoprecipitated with Tim12p, with all of Tim22p, and with a portion of Tim54p (Fig. 4B; not shown) 4B