UniProt UniProt http://www.uniprot.org Identification of Nore1 as a potential Ras effector. Identification of Nore1 as a potential Ras effector. J. Biol. Chem. (0021-9258) 1998 imex curation Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis COS7 cells have been transfected with RASSF5 and HRAS1 and stimulated with EGF or TPA. zhang@helix.mgh.harvard.edu Accepted 2006-JUL-5 by ORCHARD. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation Identification of Nore1 as a potential Ras effector. Identification of Nore1 as a potential Ras effector. J. Biol. Chem. (0021-9258) 1998 imex curation Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Accepted 2006-JUL-5 by ORCHARD. zhang@helix.mgh.harvard.edu activated mouse T cells J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation Identification of Nore1 as a potential Ras effector. Identification of Nore1 as a potential Ras effector. J. Biol. Chem. (0021-9258) 1998 imex curation Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Accepted 2006-JUL-5 by ORCHARD. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation Identification of Nore1 as a potential Ras effector. Identification of Nore1 as a potential Ras effector. J. Biol. Chem. (0021-9258) 1998 imex curation Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Accepted 2006-JUL-5 by ORCHARD. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation Identification of Nore1 as a potential Ras effector. Identification of Nore1 as a potential Ras effector. J. Biol. Chem. (0021-9258) 1998 imex curation Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu Only protein-protein interactions human-kb Homo sapiens oral epithelial carcinoma kb Human oral epithelial carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis KB cells have been stimulated with EGF. zhang@helix.mgh.harvard.edu Accepted 2006-JUL-5 by ORCHARD. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation rash_mouse GTPase HRas Hras H-Ras-1 Hras1 Transforming protein p21 c-H-ras p21ras protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein Q61411 original sequence version: 91 EE6DC2D933E2856A rasf5_mouse Ras association domain-containing protein 5 Rassf5 Nore1 Rapl New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein mouse Mus musculus Mouse MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG DIP protein Q5EBH1 original sequence version: 22 E6FF7DDE6BECB180 rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein P01112 original sequence version: 91 DIP protein P01112 original sequence version: 106 DIP protein P01112 original sequence version: 144 DIP protein P01112 original sequence version: 118 DIP protein P01112 original sequence version: 143 DIP protein P01112 original sequence version: 152 DIP protein P01112-1 original sequence version: 159 DIP protein P01112 original sequence version: 170 DIP protein P01112-1 original sequence version: 185 DIP protein P01112 original sequence version: 192 DIP protein P01112-1 original sequence version: 196 DIP protein P01112-1 original sequence version: 202 EE6DC2D933E2856A araf_mouse Serine/threonine-protein kinase A-Raf Araf A-raf Araf1 Proto-oncogene A-Raf protein protein mouse Mus musculus Mouse MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELLTPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFSTDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAMRRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP 05F8262F99DDD087 rap1b_mouse Ras-related protein Rap-1b Rap1b GTP-binding protein smg p21B protein protein mouse Mus musculus Mouse MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL CE976895E5965224 raf1_mouse RAF proto-oncogene serine/threonine-protein kinase Raf1 Craf Proto-oncogene c-RAF Raf-1 protein protein mouse Mus musculus Mouse MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDDNPFSFQSDVYSYGIVLYELMAGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF DIP protein Q99N57 original sequence version: 97 DIP protein Q99N57 original sequence version: 132 DIP protein Q99N57 original sequence version: 92 B70104AEF51C44A5 q5ebh1-1 Ras association domain-containing protein 5 Rassf5 Nore1 Rapl New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein mouse Mus musculus Mouse MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG E6FF7DDE6BECB180 rasf5_human Ras association domain-containing protein 5 RAPL RASSF5 NORE1 New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein human Homo sapiens Human MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG 4AFBC69B1325CC9E rassf5-hras1-1 4 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction The activated (GTP-bound) form of Hras1 is necessary for the interaction. 3 The species source of Hras1 is not given in the paper. Human and mouse Hras1 have identical aa seqs. rassf5-hras1-2 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 4A Interaction is detected 5 min after stimulation with EGF and decreases afterwards. Interaction is detected 20 min after stimulation with TPA. The species source of Hras1 is not given in the paper. Human and mouse Hras1 have identical aa seqs. hras1-rassf5-2 5 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Interaction was detected 5, 15 and 40 min after stimulation with EGF, and decreased afterwards. 4B hras1-rassf5-1 2 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:32:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 17:40:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association No figure. hras1-raf1-1 2 6 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 16:11:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 17:32:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association No figure. hras1-araf-1 2 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 19:44:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 18:03:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association No figure. rassf5-hras1-3 3 12 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey Q61411:p.[Gly12Val;Asp38Asn] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G V certain certain sequence position certain certain certain sequence position certain D N Wed May 02 19:11:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,asp38asn' Tue Jun 30 18:38:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Asp38Asn]' gly12val,pro34del,asp38asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P . certain certain sequence position certain certain certain sequence position certain G V certain certain sequence position certain certain certain sequence position certain D N Wed Jul 06 16:26:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'gly12val-pro34del-as' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Table I rassf5-rap1b-1 3 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Table I