UniProt UniProt http://www.uniprot.org A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. Mol. Cell. Biol. (0270-7306) 1997 Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca 13-NOV-2006: Contacted by JYOTI. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-1 by JYOTI. 13-NOV-2006: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 1997 A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. Mol. Cell. Biol. (0270-7306) 1997 Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca 13-NOV-2006: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-1 by JYOTI. 13-NOV-2006: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 1997 A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. A family of cyclin-like proteins that interact with the Pho85 cyclin-dependent kinase. Mol. Cell. Biol. (0270-7306) 1997 Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca 13-NOV-2006: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Measday V., Moore L., Retnakaran R., Lee J., Donoviel M., Neiman AM., Andrews B. brenda.andrews@utoronto.ca Accepted 2006-NOV-1 by JYOTI. 13-NOV-2006: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 1997 ccl1_yeast Cyclin CCL1 CCL1 YP9367.05C YPR025C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYRHSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPLTMEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDRCKKRITAALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGNEKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPSTEEAKKIAAKNYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT FE06E78FC38A8433 FE06E78FC38A8433 pcl1_yeast PHO85 cyclin-1 PCL1 HCS26 YNL289W N0536 G1/S-specific cyclin PCL1 Cyclin HCS26 protein protein yeast Saccharomyces cerevisiae Baker's yeast MCEYSKALHILLKSPVTDDIIKFLTDTTLRVVPSSNYPTPPGSPGEKHLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDLILDLQPLLEPIKQDLARSSDQRKRINMMMSMNRRTCAGTSPIRSNNRFKLYEKQRNVSIASDLSSATLVDSCNDLRRLKDVTNIANNTVANTNYVRTVEKWNDNVNRQSWDLEQIMSQHGF DC9E05C3C2EBD0F6 cg11_yeast G1/S-specific cyclin CLN1 YM9646.13 YMR199W CLN1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNHSEVKTGLIVTAKQTYYPIELSNAELLTHYETIQEYHEEISQNVLVQSSKTKPDIKLIDQQPEMNPHQTREAIVTFLYQLSVMTRVSNGIFFHAVRFYDRYCSKRVVLKDQAKLVVGTCLWLAAKTWGGCNHIINNVSIPTGGRFYGPNPRARIPRLSELVHYCGGSDLFDESMFIQMERHILDTLNWDVYEPMINDYILNVDENCLIQYELYKNQLQNNNSNGKEWSCKRKSQSSDDSDATVEEHISSSPQSTGLDGDTTTMDEDEELNSKIKLINLKRFLIDLSCWQYNLLKFELYEICNGMFSIINKFTNQDQGPFLSMPIGNDINSNTQTQVFSIIINGIVNSPPSLVEVYKEQYGIVPFILQVKDYNLELQKKLQLASTIDLTRKIAVNSRYFDQNASSSSVSSPSTYSSGTNYTPMRNFSAQSDNSVFSTTNIDHSSPITPHMYTFNQFKNESACDSAISVSSLPNQTQNGNMPLSSNYQNMMLEERNKENRIPNSSSAEIPQRAKFMTTGIFQNTGELTNRASSISLSLRNHNSSQL 4D7189B83D7A2B34 4D7189B83D7A2B34 pcl2_yeast PHO85 cyclin-2 PCL2 CLN4 YDL127W D2223 G1/S-specific cyclin PCL2 Cyclin HCS26 homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNYEALLKFNRKAVSKEMVQYLASTTASIIKIKKTNSMIDIALPAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITCLSPFLKPIKEEQLYKSQRDCRTLKNFSAQEKDIVNKTSISHSRSSSNMSIPSLASTSTLSTLESRRSNLSNYSNRIRTLPELHESNNISDKFSPRTYNIDSKHDNKENRPIPTIKPFNFSKARPVILKTGLNKQIIKEDTKVKKSNWSNYFKS 914BE1E2B92858CA pho85_yeast Cyclin-dependent protein kinase PHO85 PHO85 SSG3 P7102.18A Serine/threonine-protein kinase PHO85 Negative regulator of the PHO system YPL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHAS 246A4358870B00EC 246A4358870B00EC pho81_yeast Phosphate system positive regulatory protein PHO81 PHO81 YGR233C G8567 CDK inhibitor PHO81 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFGKYLEARQLELAEYNSHFIDYKALKKLIKQLAIPTLKASSDLDLHLTLDDIDEKIIHQRLQENKAAFFFKLERELEKVNGYYLARESDLRIKFNILHSKYKDYKINGKLNSNQATSFKNLYAAFKKFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLATVVSIQPIFTRDGPLKLNDETLHILLELNDIDNNNRRADIQSSTFTNDDDDDNNTSNNNKHNNNNNNNNNNNNNNNNNNILHNNYELTTSKISENQLEHLFQASSSSLDMEMEIENWYKEILNIATVKDVQRKHALLRNFRETKIFTYLLQNSSESFHKNVFSLLKECLTTLFLLLVASPLDDNSLHIFYKSNQDHIDLSYCDEDDQVFSRKNVFHEAASCPEKSRLFILDEALTTSKLSKETVQKLLNAQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSSTQRLNTIDLTPNDDKFDLDIQDSIPDFALPPPIIPLRKYGHNFLEKKIFIKLKLRPGLESIKLTQDNGIIMSSSPGRITLSSNLPEIIPRNVILPVRSGEINNFCKDISETNDEEDDDEISEDHDDGEIIFQVDSIDDFSMDFEIFPSFGTRIIAKTTAMPFLFKKVAINSIATMNLPLFDTRLNNIGSLTLDYQIIFPYPGNPLKIINYEPYWKSTGSDLMTSSKDGNFVTSSSLNGSFISVLVCALNDETIVAAPKPYVEFKGTKILLNDLTKEQLEKVVDYDFGKIDGSFDEVTLKQYLSSRVVPLRSLLEVIPGSAQLVIRVYFPTDKEIDTIPIKISPFININQFIDKLLLIIFEHERFLRHSGSGSMRQIVFSSCNWEACSILNWKQPNFPVLLQMKNLLRDSTTGKFVGDTPNCLKELAVNPQKMSYLNTELINIHTMVQFAMNNNLLGVTLPYEVLKICPSLARIIKQNGLLLIASVGENDQIPADGGYSGIYYACELLFENNIDM 9314EDB94B3F6B7D 9314EDB94B3F6B7D pcl5_yeast PHO85 cyclin-5 PCL5 YHR071W H8025.1 G1/S-specific cyclin PCL5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDGNHRFTPDSKEFNTVVKSKESSTGRNPYQTPPLEHNGTHHQTNYSRKKTNLAIIISNFLSEISRPLSNGKINNSTHNILKFLNEVLKRSKCSKENAVLATFYFQKIHQSRGVRDESSLPEFSHCSRRIFLCCLILSHKFLNDNTYSMKNWQIISGLHAKDLSLMERWCLGKLNYELAIPYDEFLLWETNTLMKAKLRVGTPANAPVKRPRESDNDYDANSWKQIKSC B6839ABB9DB5DD49 clg1_yeast PHO85 cyclin CLG1 CLG1 YGL215W G1105 Cyclin-like G1 protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MANTFKYYPETMGNSSGYPISLPFPKGSATSAVNVARQLPKYLGHVPSQSVHTQLPSMASLGYFNQPSSTYYAPPAPLQQHQQPPILPPPGLMYTSNNNSNVIPPPVQMIRDGQQQPQQSNQVNGGVSENLDYDISIMSKFIMENAFVAFNANYSTDDQTTDLFFKGISSVLNATRLPSATIFLAIDYLFKYINKLSNGIHSIGGNSINIIYQNTMIAFILANKFNDDKTFTNNSWSQATGILINVINDFERQWLRIFNWELYDSAFLYFEFVKNFEIFKQNQLKPAVAVPTLLSPIVNVGDTRNVNFNLKPTSTNNLLSPVSNYETPMLMPHNMFSSPSYQSNSRSEFSSMNGYYNYYNYNQPRLNYYQQFPNIYSSPISETQFDYDFYNFSSQQQQQQQKQHSLLPAAPQLPPPHVHNQSYGHHLGWKSMDDTINHSRFERNYFPYSAVY 579CAE1C45A2BE84 pcl7_yeast PHO85 cyclin-7 PHO85-associated protein 1 PCL7 PAP1 YIL050W protein protein yeast Saccharomyces cerevisiae Baker's yeast MELSSPSKKTTTSPINIPGGNRDNLIIGPHSHSFKTDPFSSNNSSLLSKISTNPSLESPFSSKSLLDCSPVQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKFWNDQ F81EEA8E39BC0FC5 F81EEA8E39BC0FC5 pcl8_yeast PHO85 cyclin-8 PCL8 P1745 YPL219W protein protein yeast Saccharomyces cerevisiae Baker's yeast MANDQDPNKSLINDALTRSMSEFYDDDDDNDSDMCRANDEGEDVFDLPLKVGVSQSRNFSEVNDVLDPLSSLHGPSKKVRFEQQKQQQQHQQLHNDFNTDFNLKSPSSKKMGVEQLIQSANEINDYLANNIDKVNSFNSELLSGSGKLPGRVKSDTATQGTGRLDSMSNFALSDTELDNDDDNYLLDPLANASSTTPTVEHHGYSLLDKALSTSDKEKIYTNKVNSNSQIDTDNHSHESGNTTNNETDENESSEILDYTKFDSFPYPPSSAPNGEPPDLKVLSIECEQENEKELRRISLLLDHYESIPKIPELSDDEALSKFRENIELILQLSKKINDNANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNFDGLMITCEKLEKTLHILDDTRQALGNT 1C0E7B8F126DC4CC pcl10_yeast PHO85 cyclin-10 G2838 YGL134W PCL10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDMTKNHTTDTEEFDDGDIRPVSLGIVDDYNASFELPLKPKFLQSENFSDLTSEWDQSRSNTPGLAEGKTEKAQPCGTTDSSKNRIHVEQLLESANEMNNYLAQNIENINNFQVGLLNGGKGLYSSMGDDSSACINGTNFSSTSNFELSDDELEDTTGCTSSIFDKDLFHQQNGLSIPRRRSPLFKSPTASFEIGDATDVEEQDIDDSIFSECSSITSFDMGGLHISLPHDEEEDQEKTKSESENPLLHGIPVDVEVPHISVDEALANFKETIELLLKLSGNRKCTGFNTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKLAASKLLLNELRSFCV DE6608A34BDBDF99 DE6608A34BDBDF99 ssn8_yeast RNA polymerase II holoenzyme cyclin-like subunit SSN8 SRB11 GIG3 YNL025C N2805 NUT9 UME3 Suppressor of RNA polymerase B 11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISIHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHWDKYHEQWIKFLLHTLYLRPASAI 2BA16A3374CCF207 2BA16A3374CCF207 pcl6_yeast PHO85 cyclin-6 YER059W PCL6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIKGDSPSSTNASSSPKSTYSIQSDDKANLGSGNVDIRTDNSQQDSNNRRDIVVVTRVASEETLESQSSTSSMGIRPESSFNYEDASNQARVEMNNRVHGSNMNTINKYYPVRFPKNNERQLSDTNNLNEKVQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADLLYRFWNNAKAQSQALVTGM BD8A0C7A501C94E5 BD8A0C7A501C94E5 pcl9_yeast PHO85 cyclin-9 PCL9 D1408 YDL179W protein protein yeast Saccharomyces cerevisiae Baker's yeast MISDYDALLQFNKKPVSQEMIQFLATSTASIIKIRENNNPIQGCRPPDLSIFIKNVVIQSNVQTPTLMATSVYLNKLKSVIPKNVYGINTTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDVRITTPDLIDSLSYFLGPIKEQLFLQRRQEMLLFNAPSPGQLKEYINHRRPVSHSRTSSAISVPSLTSMATVSTTDSRSSLLAKYQPSLPLVESDNFNKKNHVPLRNNNDICNNFRAEENIHSVNHIDVTMGSSPVMSHKPTIHQRLNFTRRGWSSFFKQ 183820067EC00D23 183820067EC00D23 pho85-pcl2-1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pho81 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association No figure pho85-clg1-1 2 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl6 2 16 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl7 2 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl8-3 2 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Table 2 pho85-pcl10 2 8 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 pho85-ccl1 2 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 2 pho85-ume3 2 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-cln1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl5 3 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 pho85-pcl9-1 3 8 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Table 2 pho85-pcl2-2 1 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pho85-pcl9-2 1 17 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pho85-pcl1-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2 pho85-pcl5-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2 pho85-clg1-2 1 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pho85-pcl10-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2 pho85-pcl6-1 1 16 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pho85-pcl7-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2 pho85-pcl8-4 1 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pho85-ccl1-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2 pho85-cln1-1 1 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 2