IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box. SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box. Cell (0092-8674) 1996 imex curation Bai C., Sen P., Hofmann K., Ma L., Goebl M., Harper JW., Elledge SJ. 3A Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Bai C., Sen P., Hofmann K., Ma L., Goebl M., Harper JW., Elledge SJ. 3A Accepted 2006-MAR-21 by ORCHARD. Cell (0092-8674) 1996 Only protein-protein interactions imex curation SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box. SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box. Cell (0092-8674) 1996 imex curation Bai C., Sen P., Hofmann K., Ma L., Goebl M., Harper JW., Elledge SJ. 3A Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bai C., Sen P., Hofmann K., Ma L., Goebl M., Harper JW., Elledge SJ. For Fig.4C, in-vitro translated Cdc4 was used to bind Gst-Cbf3d. Site-specific mutations were made in conserved residues of the F-box in Cdc4 and were labelled with 35-S-methionine by in-vitro translation. Bound proteins were visualized by autoradiography. For Fig 3B, gst-cyclins were isolated from 35-S-methionine-labelled insect cells using GSH-sepharose after coinfection with the indicated baculoviruses and separated by SDS-PAGE. Proteins were visualized by autoradiography. 3A Accepted 2006-MAR-21 by ORCHARD. Cell (0092-8674) 1996 Only protein-protein interactions imex curation cdc4_yeast Cell division control protein 4 CDC4 YFL009W F-box protein CDC4 E3 ubiquitin ligase complex SCF subunit CDC4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSFPLAEFPLRDIPVPYSYRVSGGIASSGSVTALVTAAGTHRNSSTAKTVETEDGEEDIDEYQRKRAAGSGESTPERSDFKRVKHDNHKTLHPVNLQNTGAASVDNDGLHNLTDISNDAEKLLMSVDDGSAAPSTLSVNMGVASHNVAAPTTVNAATITGSDVSNNVNSATINNPMEEGALPLSPTASSPGTTTPLAKTTKTINNNNNIADLIESKDSIISPEYLSDEIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFNSLNLKLSQKYPKLSQQDRLRLSFLENIFILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDANDYSRKFSYHHTNLSAITTFYVSDNILVSGSENQFNIYNLRSGKLVHANILKDADQIWSVNFKGKTLVAAVEKDGQSFLEILDFSKASKINYVSNPVNSSSSSLESISTSLGLTRTTIIP 0348F2F8FA78F3BC 0348F2F8FA78F3BC ccnf_human Cyclin-F CCNF FBX1 FBXO1 F-box only protein 1 protein protein human Homo sapiens Human MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHSQLKDLVDNHASVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSDEARAEVNGLKASRFFSLAERLNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILHCLGRVLSLFEDEEKQQQAHDLFEEAAHQGCLTSSYLLWESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASSEIVCQLFQASQAVSKQQVFSVQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTLVPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVLSLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETLLGSFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTSGYSSVSTASPTSSVDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINLCIHSEEEDMNLGLVRL DIP protein P41002 original sequence version: 97 ADB2FE41BC708898 skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 746DDE6470A69432 cbf3d-cdc4-1 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cbf3d-cdc4-2 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined leu278ala-trp316ala leupro278-279alaala, pro-279ala, ile286ala, leu290ala, trp316ala required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Shows that conserved residues within the Cdc4 F-box are required for binding to Cbf3d and mutations of these residues significantly reduced or abolished the interaction. cbf3d-cyclinf 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association BROECHERT: (protein mapping) for cyclin F have replaced Q59HD0 by P41002 (q59hd0 has seq problems and will not be merged into SP) Shows that Cbf3d is able to bind to Cyclin F in the absence of Skp2.