IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 De Vries L., Mousli M., Wurmser A., Farquhar MG. a HeLa S3 cDNA library was screened. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence De Vries L., Mousli M., Wurmser A., Farquhar MG. Annotation to indicate that this entry has been checked and accepted by a senior curator. a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 De Vries L., Mousli M., Wurmser A., Farquhar MG. a HeLa S3 cDNA library was screened. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Vries L., Mousli M., Wurmser A., Farquhar MG. Beta-gal filter (using 5-bromo-4-chloro-3-indolyl beta-D-galactoside) and Beta-gal liquid (using O-nitrophenyl-beta-galactose) assays were used to measure strength of interactions. Tables 1 and 2 Annotation to indicate that this entry has been checked and accepted by a senior curator. a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 De Vries L., Mousli M., Wurmser A., Farquhar MG. a HeLa S3 cDNA library was screened. in vitro In vitro pull down pull down predetermined predetermined participant predetermined De Vries L., Mousli M., Wurmser A., Farquhar MG. 5A Annotation to indicate that this entry has been checked and accepted by a senior curator. a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 rgs19_human Regulator of G-protein signaling 19 G-alpha-interacting protein RGS19 GAIP GNAI3IP protein protein human Homo sapiens Human MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA 925A5687DC222CBD gnai2_human Guanine nucleotide-binding protein G(i) subunit alpha-2 GNAI2 GNAI2B Adenylate cyclase-inhibiting G alpha protein protein protein human Homo sapiens Human MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF DIP protein P04899 original sequence version: 102 DIP protein P04899 original sequence version: 121 BE6D6FF720CF3DCC gnai3_rat Guanine nucleotide-binding protein G(i) subunit alpha-3 G(i) alpha-3 Gnai3 Gnai-3 protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY A65D63CE5A32C777 gnai3-rgs19-1 1 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association gnai3-rgs19-2 3 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association gnai3-rgs19-3 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays. rgs19-gnai2-1 2 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GAI2 was found to interact very weakly with GAIP. Beta-gal liquid assays estimated that the interaction produced only 6% as much Beta-gal as the rgs19-gnai3 interaction (IntAct Accession:EBI-875208) rgs19-gnai3-4 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait core domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays.