IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein-protein interactions in the yeast pheromone response pathway: Ste5p interacts with all members of the MAP kinase cascade. Protein-protein interactions in the yeast pheromone response pathway: Ste5p interacts with all members of the MAP kinase cascade. Genetics (0016-6731) 1994 Printen JA., Sprague GF. Experiments were performed both in wild type yeast and in yeast strains carrying deletions at STE4, STE5, STE7, STE11 or FUS3 to look for potential bridging molecules. These deletions had little or no effect on interaction between the hybrids. Table 3, Table 4, Fig 4 and Fig 6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Printen JA., Sprague GF. Experiments were performed both in wild type yeast and in yeast strains carrying deletions at STE4, STE5, STE7, STE11 or FUS3 to look for potential bridging molecules. These deletions had little or no effect on interaction between the hybrids. Table 3, Table 4, Fig 4 and Fig 6 Accepted 2006-MAR-17 by JYOTI. Genetics (0016-6731) 1994 kss1_yeast Mitogen-activated protein kinase KSS1 KSS1 Kinase suppressor of SST2 YGR040W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDELMKTME 5FA42161B5FD51B5 5FA42161B5FD51B5 ste11_yeast Serine/threonine-protein kinase STE11 STE11 L8039.10 YLR362W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQTQTAEGTDLLIGDEKTNDLPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEKVSSLSTATLSMNSELIPEKHCVIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYTKNVLHLLYDVELVTICHANDRVEKNRLIFVSKDQTPSDKAISTSKKLYLRTLSALSQVGPSSSNLLAQNKGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRLQKTMRESFRHSARLSIAQRRPLSAESNNIGDILLKHSNAVDMALLQGLDQTRLSSKLDTTKIPKLAHKRPEDNDAISNQLELLSVESGEEEDHDFFGEDSDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHII E9E0DF27114EEEEF E9E0DF27114EEEEF ste12_yeast Protein STE12 STE12 YHR084W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVQITNSRTEEILKVQANNENDEVSKATPGEVEESLRLIGDLKFFLATAPVNWQENQIIRRYYLNSGQGFVSCVFWNNLYYITGTDIVKCCLYRMQKFGREVVQKKKFEEGIFSDLRNLKCGIDATLEQPKSEFLSFLFRNMCLKTQKKQKVFFWFSVAHDKLFADALERDLKRESLNQPSTTKPVNEPALSFSYDSSSDKPLYDQLLQHLDSRRPSSTTKSDNSPPKLESENFKDNELVTVTNQPLLGVGLMDDDAPESPSQINDFIPQKLIIEPNTLELNGLTEETPHDLPKNTAKGRDEEDFPLDYFPVSVEYPTEENAFDPFPPQAFTPAAPSMPISYDNVNERDSMPVNSLLNRYPYQLSVAPTFPVPPSSSRQHFMTNRDFYSSNNNKEKLVSPSDPTSYMKYDEPVMDFDESRPNENCTNAKSHNSGQQTKQHQLYSNNFQQSYPNGMVPGYYPKMPYNPMGGDPLLDQAFYGADDFFFPPEGCDNNMLYPQTATSWNVLPPQAMQPAPTYVGRPYTPNYRSTPGSAMFPYMQSSNSMQWNTAVSPYSSRAPSTTAKNYPPSTFYSQNINQYPRRRTVGMKSSQGNVPTGNKQSVGKSAKISKPLHIKTSAYQKQYKINLETKARPSAGDEDSAHPDKNKEISMPTPDSNTLVVQSEEGGAHSLEVDTNRRSDKNLPDAT EE7371F18BBC0337 EE7371F18BBC0337 fus3_yeast Mitogen-activated protein kinase FUS3 FUS3 DAC2 YBL016W YBL0303 YBL03.21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS 5117980D20A1E7E2 5117980D20A1E7E2 ste5_yeast Protein STE5 STE5 NUL3 YDR103W YD8557.12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMETPTDNIVSPFHNFGSSTQYSGTLSRTPNQIIELEKPSTLSPLSRGKKWTEKLARFQRSSAKKKRFSPSPISSSTFSFSPKSRVTSSNSSGNEDGNLMNTPSTVSTDYLPQHPHRTSSLPRPNSNLFHASNSNLSRANEPPRAENLSDNIPPKVAPFGYPIQRTSIKKSFLNASCTLCDEPISNRRKGEKIIELACGHLSHQECLIISFGTTSKADVRALFPFCTKCKKDTNKAVQCIPENDELKDILISDFLIHKIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIPSGANSILADTSVALSANDSISAVSNSVRAKDDETKTTLPLLRSYFIQILLNNFQEELQDWRIDGDYGLLRLVDKLMISKDGQRYIQCWCFLFEDAFVIAEVDNDVDVLEIRLKNLEVFTPIANLRMTTLEASVLKCTLNKQHCADLSDLYIVQNINSDESTTVQKWISGILNQDFVFNEDNITSTLPILPIIKNFSKDVGNGRHETSTFLGLINPNKVVEVGNVHDNDTVIIRRGFTLNSGECSRQSTVDSIQSVLTTISSILSLKREKPDNLAIILQIDFTKLKEEDSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDSISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYRCFTSFGRRRPNELKIKVGYLNVDYSDKIDELVEASSWTFVLETLCYSFGLSFDEHDDDDEEDNDDSTDNELDNSSGSLSDAESTTTIHIDSPFDNENATANMVNDRNLLTEGEHSNIENLETVASSVQPALIPNIRFSLHSEEEGTNENENENDMPVLLLSDMDKGIDGITRRSSFSSLIESGNNNCPLHMDYI 0435BDA0196B2D6F 0435BDA0196B2D6F ste7_yeast Serine/threonine-protein kinase STE7 STE7 D1525 YDL159W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH C8A75899CFBE8BDE C8A75899CFBE8BDE ste5-ste11-1 1 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Beta-galactosidase activity - 1112 units ste5-ste7-1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Beta-galactosidase activity - 333 units ste5-fus3-1 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Beta-galactosidase activity - 120 units ste11-ste5-1 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-877655]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-877655]1-435 [EBI-877655]P23561,2 P23561:p.Pro279Ser mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Wed May 02 19:07:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro279ser' Tue Jun 30 18:06:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro279Ser' physical association physical association Beta-galactosidase activity - 28 units ste11-ste11-2 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-877666]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-877666]1-435 [EBI-877666]P23561,2 3 unspecified role unspecified role prey prey physical association physical association Beta-galactosidase activity - 65 units ste11-kss1-1 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait P23561:p.Pro279Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Wed May 02 14:58:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro279ser' Tue Jun 30 17:50:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro279Ser' physical association physical association Beta-galactosidase activity - 30 units ste5-ste7-2 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Beta-galactosidase activity - 93 units ste7-fus3-4 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Beta-galactosidase activity - 89 units ste7-kss1-3 1 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role prey prey physical association physical association Beta-galactosidase activity - 249 units fus3-ste11-1 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait P23561:p.Pro279Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Wed May 02 15:25:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro279ser' Tue Jun 30 18:55:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro279Ser' physical association physical association Beta-galactosidase activity - 44 units ste11-kss1-2 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Beta-galactosidase activity - 1050 units ste7-ste11-1 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Beta-galactosidase activity - 163 units ste7-kss1-4 1 7 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Beta-galactosidase activity - 2 units ste12-kss1-1 1 2 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Activation domain to be placed at the carboxyl terminus of the hybrid rather than at the amino terminus, otherwise domain appears to interfere with interaction. Beta-galactosidase activity - 147 units