MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of F-box proteins that are involved in resistance to methylmercury in Saccharomyces cerevisiae. Identification of F-box proteins that are involved in resistance to methylmercury in Saccharomyces cerevisiae. FEBS Lett. (0014-5793) 2006 imex curation Hwang GW., Ishida Y., Naganuma A. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hwang GW., Ishida Y., Naganuma A. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation ucc1_yeast F-box protein UCC1 UCC1 Ubiquitination of citrate synthase in the glyoxylate cycle protein 1 YLR224W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNQSDSSLMDLPLEIHLSLLEYVPNELRAVNKYFYVLHNHSYKEKSLAWIAEDNYIWAVVKHSLCLYVKSLDPLRQHAREIIQETKEPGFNVPLCMTKYIADSWYIVYNALQYPGKIINMGWDKYTKSQDSNGSDSTSNFNSRPKERTLMQSLTALPVNFWSRRKDEPTPVNVWFYVKNAHVARYIPKIITEIGICNYGPKQIVASAGYINELITSEGIYCVNLGHLPRLYDEQIFEGTGTTHLPLELKAIDRTDSDVCINGDLVLLGYDFIPYQISKPWLLFRIEPVNSIEAIFNYSECSFSYQFAWSLACLQSEEKISFPRDTIIGHGLPYKPSKLIRIFVYKHPEQKQDLGQEIALPNWNTPYLRR 4C9FA5962E3A9851 hrt3_yeast F-box protein HRT3 YLR097C HRT3 High level expression reduces Ty3 transposition protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIVDYEKDPRAKEAIAIWEKGVLKEKDGSMSDAINFYRSALKIHDNVESLYRKKILDEWMLHKKLSGLSMTTDAPDEQNETGKDDLSVEENAELQPCWILEILPDDILLRIIKKVILMSGESWVNLSMTCSTFSKLCFHDSVPFKTFAKYIYSKQIYDKMAMDLNGITDINTFEKEIWRGDDYRMLRERPYIKFEGVYISVVNYVRYGSNAESSLSLLKPVHMITYYRYFRFYENGQCLRLLSTDEPSAVVKHFSKENKPRHSHMCYWSLGFDYDFGHLKITRSDEKYTFIEEFQIKNQGNKRYQRLKWLSSIVVDKEGNASNCSLRNEKSFFFSRVKSFKDPG C2AF89147E313D93 C2AF89147E313D93 skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 746DDE6470A69432 skp1-hrt3 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3982393: original sequence: 100-148 : LEILPDDILLRIIKKVILMSGESWVNLSMTCSTFSKLCFHDSVPFKTF flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A FEBS-Letters homomint mint skp1-yl224 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-3982409: original sequence: 8-45 : LMDLPLEIHLSLLEYVPNELRAVNKYFYVLHNHSYKE physical association physical association F2B FEBS-Letters mint