MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A molecular insight of Hes5-dependent inhibition of myelin gene expression: old partners and new players. A molecular insight of Hes5-dependent inhibition of myelin gene expression: old partners and new players. EMBO J. (0261-4189) 2006 imex curation Liu A., Li J., Marin-Husstege M., Kageyama R., Fan Y., Gelinas C., Casaccia-Bonnefil P. 2009-01-08 Only protein-protein interactions mouse-oligodendrocyt Mus musculus oligodendrocyte oligodendrocyte anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu A., Li J., Marin-Husstege M., Kageyama R., Fan Y., Gelinas C., Casaccia-Bonnefil P. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation hes5_rat Transcription factor HES-5 Hes5 Hes-5 Hairy and enhancer of split 5 protein protein rat Rattus norvegicus (Rat) Rat MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW mint Transcriptional repressor of genes that require a bHLH protein for their transcription CAA5046F07B1B0C1 sox10_rat Transcription factor SOX-10 Sox10 protein protein rat Rattus norvegicus (Rat) Rat MAEEQDLSEVELSPVGSEEPRCLSPSSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGETDQGGAAAIQAHYKSAHLDHRHPEEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGEISHEVMSNMETFDVTELDQYLPPNGHPGHVGSYSAAGYGLSSALAVASGHSAWISKPPGVALPTVSPPAVDAKAQVKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHAGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP 094B0C5E42D83454 ascl1_rat Achaete-scute homolog 1 Ascl1 Ash1 Mash-1 protein protein rat Rattus norvegicus (Rat) Rat MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQAPQQQAPQLSPVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF mint May play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. Essential for the generation of olfactory and autonomic neurons. Activates transcription by binding to the E box (5'-CANNTG-3') 036BDAC8E2D23274 hes5-ascl1 1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3376303: original sequence: 29-166 : RDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRP Stoichiometry: 1.0 physical association physical association F6B F6C EMBO-Journal homomint mint hes5-sox10 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3376321: original sequence: 29-166 : RDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRP myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F7A F7B EMBO-Journal homomint mint