MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Dcr2 targets Ire1 and downregulates the unfolded protein response in Saccharomyces cerevisiae. Dcr2 targets Ire1 and downregulates the unfolded protein response in Saccharomyces cerevisiae. EMBO Rep. (1469-221X) 2006 imex curation Guo J., Polymenis M. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Guo J., Polymenis M. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation Dcr2 targets Ire1 and downregulates the unfolded protein response in Saccharomyces cerevisiae. Dcr2 targets Ire1 and downregulates the unfolded protein response in Saccharomyces cerevisiae. EMBO Rep. (1469-221X) 2006 imex curation Guo J., Polymenis M. 2009-01-08 Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Guo J., Polymenis M. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation ire1_yeast Serine/threonine-protein kinase/endoribonuclease IRE1 IRE1 ERN1 YHR079C Endoplasmic reticulum-to-nucleus signaling 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRLLRRNMLVLTLLVCVFSSIISCSIPLSSRTSRRQIVEDEVASTKKLNFNYGVDKNINSPIPAPRTTEGLPNMKLSSYPTPNLLNTADNRRANKKGRRAANSISVPYLENRSLNELSLSDILIAADVEGGLHAVDRRNGHIIWSIEPENFQPLIEIQEPSRLETYETLIIEPFGDGNIYYFNAHQGLQKLPLSIRQLVSTSPLHLKTNIVVNDSGKIVEDEKVYTGSMRTIMYTINMLNGEIISAFGPGSKNGYFGSQSVDCSPEEKIKLQECENMIVIGKTIFELGIHSYDGASYNVTYSTWQQNVLDVPLALQNTFSKDGMCIAPFRDKSLLASDLDFRIARWVSPTFPGIIVGLFDVFNDLRTNENILVPHPFNPGDHESISSNKVYLDQTSNLSWFALSSQNFPSLVESAPISRYASSDRWRVSSIFEDETLFKNAIMGVHQIYNNEYDHLYENYEKTNSLDTTHKYPPLMIDSSVDTTDLHQNNEMNSLKEYMSPEDLEAYRKKIHEQISRELDEKNQNSLLLKFGSLVYRIIETGVFLLLFLIFCAILQRFKILPPLYVLLSKIGFMPEKEIPIVESKSLNCPSSSENVTKPFDMKSGKQVVFEGAVNDGSLKSEKDNDDADEDDEKSLDLTTEKKKRKRGSRGGKKGRKSRIANIPNFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESKNVSDENLKLQKEYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQSSFRTNLNNPSGTSGWRAPELLEESNNLQCQVETEHSSSRHTVVSSDSFYDPFTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS BD65D74E74365945 BD65D74E74365945 dcr2_yeast Phosphatase DCR2 DCR2 Dosage-dependent cell cycle regulator 2 YLR361C protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRLPRLYQRYLLYLVVFVVIALFYFLQAPRVEEHIGFDLALPISHVDNLWFQNKGLEGFSNDDKLVVNIGYDECFHIGRFYEGCFNRHELKSTLTDGHQYLQRKRIHKDLRGSFGRRWFGKSEYLYYDVLYPALVDYFGSNLEKLNVEAVTGISKYPKDKSLPFMDVSITFEPISIELLQKRSYISDINILFGVDCIQPIANWTLQKEFPLVKYRYSEPAYLTYKFVGTRPVDTGAQRLQETDEGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFSPHDTHDNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAPKYNSEGITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQSMLDGNSPESV 8B9AECAEACF2564C dcr2-ire1 2 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 dephosphorylation dephosphorylation reaction dephosphorylation F4A mint dcr2-ire1-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level P32361:p.Ser841Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:50:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:46:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser841ala' Tue Jun 30 19:23:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser841Ala' range MINT-3380918: original sequence: 841-841 : LCKKLDSGQSSFRTNLNNPS P32361:p.Ser840Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:07:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:24:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser840ala' Tue Jun 30 15:43:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser840Ala' range MINT-3380921: original sequence: 840-840 : GLCKKLDSGQSSFRTNLNNP tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B mint