MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The budding yeast Pichia pastoris has a novel Sec23p homolog. The budding yeast Pichia pastoris has a novel Sec23p homolog. FEBS Lett. (0014-5793) 2006 imex curation Esaki M., Liu Y., Glick BS. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Esaki M., Liu Y., Glick BS. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation The budding yeast Pichia pastoris has a novel Sec23p homolog. The budding yeast Pichia pastoris has a novel Sec23p homolog. FEBS Lett. (0014-5793) 2006 imex curation Esaki M., Liu Y., Glick BS. 2009-01-08 Only protein-protein interactions picpa Pichia pastoris (Yeast) Yeast Pichia pastoris fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Esaki M., Liu Y., Glick BS. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation sec24_picpa Protein transport protein SEC24 SEC24 protein protein picpa Pichia pastoris (Yeast) Yeast Pichia pastoris MSGKRRAYPSMQYPATEPVATGGSFGYGQQPGAQAYGQQFTPGAGIAGQQLPGATQPNLNGQGAPYGAPGGDQLAQGMSSLNIQPNQQPQPVHQFPSQQQGYINPGAGLGVPPTQAAGPYGVPAAVAPQQQSAQLGYAGPPYGNTYDQQQPQQAAFPFNQLYTADLLKELPPPISDLELPPPPIVLPQGASLTGKPESNASPEYFRCTLNVIPNNNSLLKKSKLPLAVVVNPYQCLRDEDEPVPVVEDTLISRCRRCRSYINPLITFVDRNTKWRCNLCNLTNDVPSGFDFDKDTQQRVDRMARVELNYSVVEFVAPKEYMVRLPQPLVYLFVLDVSTHAIQNGYLATVARTILDSLDQIPNKDGRARVGFIGVDSSLHFFTIPQDSEDENDAQETSMLVVSDLDDVIVPAAENLLAPLQQSRQNIENLLNNFHSYFENNVNPNFALGPALKAGHRLINNIGGKMIVFTSTLPNKGIGALSIRDEEAHSGKAKESSALLSPNDSFYKSFAVECNKSQVTVDMFLASSSYQDVATLSNLPRYTAGQTHFYPAWTAAREEDITKLSKEISNHLSMNINLEAVLRVRGSAGLRMNAFYGNFFNRSSDLCSFPTFPRDQSYLIEISIDEHITKPLAAFQAAVLHTTSFGERRIRVMTLEVPIGKELNQIYASADQLAITNYFTHKAVEKALSSSLIDAREYLNRSLLDIFQVFKKELVAGNLGSSSPLQLCNNLKMLPLLLHSLTKYIAFRPGKVPSDHRAYALNLLASSPIQRLIKFIYPTIYSLHDMADECGLPEELEETYVNEAGEEVTEPIDGDIVLPEPINDTSTLLAPYGLYLIDSGTDLFLYVGGESVPQLLLDVFGVDNPGYIKYGKSELPELNNEFNERLRNVINRVREGKDRITYQNLQIVIGQSKQRTGVPDRIQEDLTPLRLWCFSHLVEDRVGGGTAYREYLNQIREKLSS mint Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules 0B47A40FC5498D13 sec13_kompg Protein transport protein SEC13 SEC13 PAS_chr1-3_0057 protein protein picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris MVTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIDGENQRLVETLIGHEGPVWQVAWAHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASSDGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISLPDNTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATASQDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVDQ mint Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. SEC13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution C711A2810ED1F049 sar1_kompg Small COPII coat GTPase SAR1 SAR1 PAS_chr1-1_0180 protein protein picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris MWVLNWFQDVLASLGLWNKHAKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELSIGNVRFTTFDLGGHEQARRVWKDYFPEVDGIVYLVDIADPERFEESRVELDALLKIEELSKVPVLVLGNKIDKSTAVSENELRHALGLMTTTGKDKVQLVEGQRPLEVFTCSIYLRQGYGEGIRWLSQYI mint Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. SAR1 controls the coat assembly in a stepwise manner. Activated SAR1-GTP binds to membranes first and recruits the SEC23/24 complex. These SEC23/24-SAR1 prebudding intermediates are then collected by the SEC13/31 complex as subunits polymerize to form coated transport vesicles. Conversion to SAR1-GDP triggers coat release and recycles COPII subunits D2D06FE800FB8DF3 q0pvd9_picpa Protein transport protein SEC23 SHL23 protein protein picpa Pichia pastoris (Yeast) Yeast Pichia pastoris MDQDAFETIEDIDGVRFTWNAFPRTKIEAARCCVPIACIYTPLKQRENLAIIQEDPMICRACKAIFNPFVTVQAQHWICSFCATLNVLLPHYQNQIPYQASGDCTTIEYVLSKRVSSPPAYVYLVDTSLEAQELESLKESILNSFQLLPKYALVSLITFGRNVNVHELEDGLAHNYYTFNGSKTYDLTSIQRSLGLLSRDLRRKDASESVGGRFLKPLGVCEFSLSEVVQSLKPDVWPKGKFQRSLRATGAALDVALHFMDTCLGKTGAHLMLFAGGPCTLGPGIVVGSELKEPIRSHYEIQNGSAKHYKKSLKHYAALAKRATSQCHSVDVFAASYDQIGLSEMELLVDQTGGALVLTDAFSTAIFKQSFQRFLQLPMGINGTLEVKTSFDLKINGLVGHAISLERKAKNVSDTEIGRGKTDAWKLCNLLPQSSFGIYFEMPATNSSQTTTKPRSLIQFITYYQEIGGTLRLKVTTLAKPILQQSQESLIAEYFDQEAAVVLISRQMIDKMVKDNSTEVIRELDKILVELCKKFGSYQKNDLQSFRLGAKFSLFPQFLYHLRRSQFMQVFNNSPDETTFYRHSILTEDTFNSLIMIQPTLTAYEINQEPQPIFLDSMSITADRILLLDTFFQIVIYHGETIVQWREAKYQEQEEFAYLKDFFQLPREDAADLLIDRFPLPRFIDCDAGGSQARFLLSKVNPTTSYKDNQMASASQSGGAIVGSDDVSLQSFMEHVQMVVVKSV mint 0590F98E1666D60E q0pvd7_picpa LST1 protein protein picpa Pichia pastoris (Yeast) Yeast Pichia pastoris MEATHSMNAVYDGYSMSSLSDGMSELKVDQSKHKKRPVHILHQQPASQTTAQFHQPASSQPFLPPQVPFSQQPQSPNFVQGSPQIGTPQMGTPPLGVSQFGTPQGQIQSPGQLHQTFSPPSNLDPTSVPDIRYETDVMFDSKSFLTFANVCPPLVGTQYTVVDQGNASPRFMRMSMYNVPATEKLRKETGLSLGLVLNPFAPMQEQEKPIPEVDYREMGGPPRCRRCRAYVNSTMQHTHDYRMICNICGFSSPIPSEYCSPLDPSGVRIDRNQRPELHLGMIDFLVPEAYNIDESIPPNPLHHVFLVDISNSSVRRELHKAFANAISMSVLKGYPKGSKISIIAYDRKIHFFNLSLDSNQVSIATVSDLEDPFLPFFDGIFVDVKAGRIHIDRALQSLEMMGEYSEPEPAYGAALRYALLALEHVGGGKVTALLSALPSWGPGSLKGISPSQRLTSELETEALTAKNQYYQKLSKDYISASVGLDLFVVSSGSVDLSDCSLVATSTGGSVRSFFNYEVARDQKSLCISLLDSIQAVKGYQSQLKIRCSAGLQVTKYLGSFKTSNSDADPLIPIVTSNTSVGCLFKHDGKLSTKNDAHFQAALLYTSADGVRKVRVINSIISVTERIADVFAFADQDATLALELKEHLGRIPEVSLVGLRNRLTFDLVDINTDYKLKVVGKSSADQQLILPVGLRTLPMFTLAATKTRAIRSAPSNNTDLRVQSILDLKSFTLEKLAVYLYPILINVLEIDEDACQYTSTGHFQLPPGTRLSRQNLMHGGAYILFNGLKVFFWIHSDVNVLLLQDVFGQNVSSLDSIDPNLNELPELDTGISLQLRNLVSFFAKSYLNSSFVPIQICRFRRDGAEVEFMENLYEDSTPDKLQSYHDFLNHIHSLIKNKVAVSSEKKNQMNGQMMEMNHLR mint A402DD33565974D2 q0pve0_picpa Protein transport protein SEC23 SEC23 protein protein picpa Pichia pastoris (Yeast) Yeast Pichia pastoris MADIYEIEEIDGVRFNWNSFPVTKIESENISMPLGCLYTPLNERDYLPVAQYDPVLCRQCHAALNPYAMIDLTAKVWSCPVCSSRNTLPINYTEISTENLPLELNPQSSTIEYILSRAQPHPPPAYIYVVDLCQEQSELDSMKETLIASLPLHPPGALIGLVTFDSVVNVHDLSTRTCLKKYVFNGTKEYTSIEIQRQLGIEKSGTIPWAKQLQNPGYNAVTRFFLPVAEKDAEFQIIRAIERLEVSKWTYPQGQRPTRVTGAALSVATSLAEGSYADCACKITLFSAGPCTLGPGTIVGPELKEPIRSHNDMDKGTASHYKKSYQFYNRLAVKGSNNRKDLKDKFADPSSSTTYSVDIFAGCYDQVGIYEMRSLANLTGGVLVVTDSFQTSILKNSFFACFNKDEEGYPMTYSDGILDVLTSNRLKVSGVIGHAVSMKQNGNNISDTPIGEGLTNKWRLCSLTPKNTYAIFFDMMTVGTSDQRSSSVNEVCIQFTTTYRHTNGQMRTRVTTLKRGTSNTVPLANSFDQEAAAVLYARLIVNKIENGNEYSDLLRWIDKSLVKLCTVFGDYSKNDAGTFRLSTKFSLLPQFIYHLRRSQFLQVFNCSPDETAFYHHTILRTDIRDSLVMIQPTLTQFSADGSEPVPVLLDSASLKQDCVLLLDAFFFIVIYYGSVAAAWRDANYPREEFPGVYAMIEKAQEEAASLISDRFPLPKYVTTDEGKSQARFLYSKLNPSENDTETTGSALAGYTASAHEAIVQSDDVSLNTFFTHLSRLVVQNSS mint 36E6FC00BC18BF0C q9p4c6_picpa SEC12 protein protein picpa Pichia pastoris (Yeast) Yeast Pichia pastoris MMKPYTLDTGYPVYGAKFITKRTLLTAGGGGEGNNGIPNKLSGFRIDFTKVKAVQKFRELTLSANEDCPMSLDAANNVILLGVNENTSSIKQGKNNHLRKFGYINHHLKYLDKQQLSNSRDNRDYQKFTHLSSDASVACIATSKVPTTIYVVDPQTLEKKFDLETGVDVKDMHISPDGKIVCYVCANSLHGYSTVTAKLLFKDDSFKNHTLMKVKFLDQHHLLIVGSQKQGISLIHYSLAKNSIVNSRVISKKLKGVTSLDTRNGVIALSGNDNSLLLIKVSNLKPIKQFNKIHKFSITSCCFNKTGDLLATVSAANTVSVMEIPKGLATKKSLPRKIFNYFILTVFMAILAIVLQWSIENGHLQHAWQKLLNGDVIDSSRYFKVESIPDEELSASLLESSYSGLSSETKSVTDAISASVPIIETTVDTTTTSNSVRRTIPEGYSTAKEFQPDKIKLYKSSLDSDPSADSTGSFTVSITETQSSSIKPQKSKKTKKLKKKTSSTATPGSSTALVETLIVSTSPQSVDTSLSVTSPVASSTAQDSYLTSSAHSALTTKGAKKLKKKRKIKTKTVKTTKTTETETETETIVQDDLADITISSDIVSDISSEVSNSETVVQEGLPTEVIESLLNKDPTVDEPIAEESAIIDLPLGKPVTEKLTLDTQEAIESSVDEPAIGIDIEDAIVADEKEEPLTADDAVLDGEEREIEDPDEIPSEVLTDVADSPEEYQDDININNSQEATSTHDSNVSEETAAPVEETQESVGTDDQAEPEKFDEEEKTENEHQYEKDDHSELAEETQESHDDQVDEVEEVLEEVKDFLGETKDVLEEAKFVLEEAQEGAEVSDKTELTEQDETEKFIESSDALRSSVGTVEATEQTTATSVDPNTEIDTKTTSEAVIESNTPVENEESTVEDREINSSIDEIAEKSISQEEIVSKLEDSSSENNEGEREEEEIEESEDEKAGDIEEEEEEYEDDDDEYENVGTEEEKDEEEVQGDHEEQEDEEEVDDEEEEDDDEDEEDEDEDEDEEGENINHDEL mint FE23F286859EBB36 sec13-sec23 2 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4A FEBS-Letters mint sec13-shl23 2 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4A FEBS-Letters mint lst1-sec13 2 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4A FEBS-Letters mint sec13-sec24 2 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4B FEBS-Letters mint sec12-sec13 2 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F5 FEBS-Letters mint sec23-sec23 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint sec23-sec24-4 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint sec23-lst1 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint shl23-lst1 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint sec24-sec23-1 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint lst1-sec23 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint lst1-shl23 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint sar1-shl23 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:47 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' His79Gly range MINT-3371047: original sequence: 79-79 : FDLGGHEQARRVWKDYFPEV Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint sar1-sec23-2 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:27:15 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' His79Gly range MINT-3371068: original sequence: 79-79 : FDLGGHEQARRVWKDYFPEV Stoichiometry: 1.0 physical association physical association F6 FEBS-Letters mint