IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis. A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis. Plant J. (0960-7412) 2006 de Folter S., Shchennikova AV., Franken J., Busscher M., Baskar R., Grossniklaus U., Angenent GC., Immink RG. All assays involving petunia proteins only were conducted using 1mM 3-amino-1, 2, 4-triazole (3-AT), whereas all assays involving arabidopsis (or in combination with petunia proteins) were proteins were conducted using 30mM 3-AT. UniProt accession numbers for proteins identified in the text were mapped from given identifiers or from references within the text. richard.immink@wur.nl 01-DEC-2006: Contacted by JYOTI. Petunia ovary specific cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence de Folter S., Shchennikova AV., Franken J., Busscher M., Baskar R., Grossniklaus U., Angenent GC., Immink RG. All assays involving petunia proteins only were conducted using 1mM 3-amino-1, 2, 4-triazole (3-AT), whereas all assays involving arabidopsis (or in combination with petunia proteins) were proteins were conducted using 30mM 3-AT. UniProt accession numbers for proteins identified in the text were mapped from given identifiers or from references within the text. richard.immink@wur.nl Accepted 2006-NOV-17 by JYOTI. 01-DEC-2006: Contacted by JYOTI. Petunia ovary specific cDNA library Plant J. (0960-7412) 2006 A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis. A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis. Plant J. (0960-7412) 2006 de Folter S., Shchennikova AV., Franken J., Busscher M., Baskar R., Grossniklaus U., Angenent GC., Immink RG. All assays involving petunia proteins only were conducted using 1mM 3-amino-1, 2, 4-triazole (3-AT), whereas all assays involving arabidopsis (or in combination with petunia proteins) were proteins were conducted using 30mM 3-AT. UniProt accession numbers for proteins identified in the text were mapped from given identifiers or from references within the text. richard.immink@wur.nl 01-DEC-2006: Contacted by JYOTI. Petunia ovary specific cDNA library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined de Folter S., Shchennikova AV., Franken J., Busscher M., Baskar R., Grossniklaus U., Angenent GC., Immink RG. All assays involving petunia proteins only were conducted using 1mM 3-amino-1, 2, 4-triazole (3-AT), whereas all assays involving arabidopsis (or in combination with petunia proteins) were proteins were conducted using 30mM 3-AT. UniProt accession numbers for proteins identified in the text were mapped from given identifiers or from references within the text. richard.immink@wur.nl Accepted 2006-NOV-17 by JYOTI. 01-DEC-2006: Contacted by JYOTI. Petunia ovary specific cDNA library Plant J. (0960-7412) 2006 tt16_arath Protein TRANSPARENT TESTA 16 MKD15.12 AGL32 Arabidopsis BSISTER MADS-box protein TT16 ABS At5g23260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKIEIKKIENQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCSEQNRMPQLIDRYLHTNGLRLPDHHDDQEQLHHEMELLRRETCNLELRLRPFHGHDLASIPPNELDGLERQLEHSVLKVRERKNELMQQQLENLSRKRRMLEEDNNNMYRWLHEHRAAMEFQQAGIDTKPGEYQQFIEQLQCYKPGEYQQFLEQQQQQPNSVLQLATLPSEIDPTYNLQLAQPNLQNDPTAQND 2C4ECB9D9C1DEEA8 ag_arath Floral homeotic protein AGAMOUS F13C5.130 AG At4g18960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV 4E7591AD85654C1C q40882_pethy fbp11 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANNNIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQELSMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE 1658ABF23C1FC7AE sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI DIP protein O22456 original sequence version: 117 DIP protein O22456 original sequence version: 110 0057CABD3F1AFC40 ag_pethy Floral homeotic protein AGAMOUS pMADS3 AG1 MADS3 protein protein pethy Petunia hybrida (Petunia) MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQQMNLMPGSSSYDLVPPQQSFDARNYLQVNGLQTNNHYPRQDQPPLQLV A5249306B807A6BD fbp24_pethy MADS-box protein FBP24 FBP24 Floral-binding protein 24 protein protein pethy Petunia hybrida (Petunia) MIIMGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYCSQPHSMSQIISRYLQTTGASLPVEDNRVQLYDEVAKMRRDTLNLQLSLQRYKGDDLSLAQYEELNELEKQLEHALNKIRARKLELMQQQMENLKKTEKMLEKENHDMYQWLMNNQMYKQESAAMDHEDHHHHHEHQQAITELNLLGEQPLLSHFTFFGDQEQPSTSTVNHFASISLTSPPANSISPYRLQPSHPNLQDSHVHGPSYD 4C854DB87F36F16A agl11_arath Agamous-like MADS-box protein AGL11 AGL11 At4g09960 T5L19.90 STK Protein SEEDSTICK protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVERYQQHHHQMVSGSEINAIEALASRNYFAHSIMTAGSGSGNGGSYSDPDKKILHLG 336C383355E6CB51 agl1_arath Agamous-like MADS-box protein AGL1 Protein SHATTERPROOF 1 AGL1 SHP1 At3g58780 T20N10_130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEGGSSHDAESSKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVRGTIERYKKACSDAVNPPSVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNELLVAEIEYMQKREMELQHNNMYLRAKIAEGARLNPDQQESSVIQGTTVYESGVSSHDQSQHYNRNYIPVNLLEPNQQFSGQDQPPLQLV D377C47F231F2099 agl9_pethy Agamous-like MADS-box protein AGL9 homolog Floral homeotic protein FBP2 Floral-binding protein 2 FBP2 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITVGGAGPSVNNYMAGWLP B575BE9468D310BB q5xxe7_arath SHP2 At2g42830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGGASNEVAESSKKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVRGTIERYKKACSDAVNPPTITEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKREIELQNDNMYLRSKITERTGLQQQESSVIHQGTAYESGVTSSHQSGQYNRNYIAVNLLEPNQNSSNQDQPPLQLV D4C6319CEE5606D9 q43616_pethy fbp7 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNNNIRAIIDRYKKATVETSNAFTTQELNAQFYQQESKKLRQQIQLIQNSNRHLVGEGLSSLNVRELKQLENRLERGIARIRSKKHEMILAESEDLQKREIQLEQENAFLRSKIAENERLQELSMMPAGGQEYNAIQQYLARNMLQLNMMEGVPSYPLPSDKKSLDLE 56AE8DAEE198CC84 fbp24-fbp2-fbp7 2 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of FBP2 (amino acid residues 1 to 182) was shown to be required for complex formation. fbp24-fbp2-fbp11 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of FBP2 (amino acid residues 1 to 182) was shown to be required for complex formation. fbp24-fbp2-mads3 2 11 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of FBP2 (amino acid residues 1 to 182) was shown to be required for complex formation. stk-sep3-abs_1 2 3 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role ancillary ancillary physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. stk-sep3-abs_2 2 6 unspecified role unspecified role ancillary ancillary 3 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. ag-sep3-abs_2-1 2 6 unspecified role unspecified role ancillary ancillary 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. ag-sep3-abs_1 2 6 unspecified role unspecified role ancillary ancillary 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. abs11-sep3-shp1 2 3 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role ancillary ancillary physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. abs11-sep3-shp1-1 2 3 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role ancillary ancillary physical association physical association Table 1 Higher-order complex formation for the petunia and Arabidopsis Bs proteins. The presence of SEP3 was shown to be required for complex formation. fbp11-fbp24 1 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association A petunia ovary specific cDNA expression library was screened by the yeast two hybrid GAL4 system with FBP11 (Angenent et al 1995; Colombo et al 1995) as bait to identify interacting partners for this ovule specific MADS-domain protein (Immink et al 2002).One of the interacting partners identified was a truncated MADS-domian protein, designated FLORAL BINDING PROTEIN 24 (FBP24).