MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. Structure of the Keap1:Nrf2 interface provides mechanistic insight into Nrf2 signaling. EMBO J. (0261-4189) 2006 imex curation Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. 2009-01-08 Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lo SC., Li X., Henzl MT., Beamer LJ., Hannink M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation keap1_human Kelch-like ECH-associated protein 1 Cytosolic inhibitor of Nrf2 Kelch-like protein 19 KEAP1 INRF2 KIAA0132 KLHL19 protein protein human Homo sapiens Human MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC DIP protein Q14145 original sequence version: 107 DIP protein Q14145 original sequence version: 138 DIP protein Q14145 original sequence version: 153 DIP protein Q14145 original sequence version: 106 DIP protein Q14145 original sequence version: 163 CE180F3897BB8C97 nf2l2_human Nuclear factor erythroid 2-related factor 2 NFE2L2 NRF2 Nuclear factor, erythroid derived 2, like 2 HEBP1 protein protein human Homo sapiens Human MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN DIP protein Q16236 original sequence version: 80 DIP protein Q16236 original sequence version: 103 DIP protein Q16236 original sequence version: 148 DIP protein Q16236 original sequence version: 102 DIP protein Q16236-1 original sequence version: 113 99FAFD811B6C1416 keap1-nfe2l2-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2844510: original sequence: 315-359 : QVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADL Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2844505: original sequence: 68-94 : KAFFAQLQLDEETGEFLPIQPAQHIQ Stoichiometry: 1.0 direct interaction direct interaction F2B EMBO-Journal kd 20 nanomolar homomint mint keap1-nfe2l2-2 1 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2844524: original sequence: 68-94 : KAFFAQLQLDEETGEFLPIQPAQHIQ Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2844515: original sequence: 315-359 : QVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADL Stoichiometry: 1.0 direct interaction direct interaction F3 EMBO-Journal homomint mint keap1-nfe2l2-3 2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Tyr334Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:49:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:26:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr334ala' Tue Jun 30 19:53:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr334Ala' range MINT-2844561: original sequence: 334-334 : VGRLIYTAGGYFRQSLSYLE Q14145:p.Arg336Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:06:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:01:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg336ala' Tue Jun 30 20:18:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg336Ala' range MINT-2844567: original sequence: 336-336 : RLIYTAGGYFRQSLSYLEAY Q14145:p.Phe335Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:06:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:11:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe335ala' Tue Jun 30 17:39:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe335Ala' range MINT-2844564: original sequence: 335-335 : GRLIYTAGGYFRQSLSYLEA Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-4 2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Gln337Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Tue Jul 12 10:06:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:12:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln337ala' Tue Jun 30 17:24:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln337Ala' range MINT-2844579: original sequence: 337-337 : LIYTAGGYFRQSLSYLEAYN Q14145:p.Ser338Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:07:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:46:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser338ala' Tue Jun 30 17:08:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser338Ala' range MINT-2844573: original sequence: 338-338 : IYTAGGYFRQSLSYLEAYNP Q14145:p.Leu339Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:49:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:38:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu339ala' Tue Jun 30 19:15:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu339Ala' range MINT-2844576: original sequence: 339-339 : YTAGGYFRQSLSYLEAYNPS Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-5 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Ile435Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:06:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:27:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile435ala' Tue Jun 30 18:24:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile435Ala' range MINT-2844602: original sequence: 435-435 : IYAVGGSHGCIHHNSVERYE undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:17:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Met436Ala range MINT-2844605: original sequence: 436-436 : YAVGGSHGCIHHNSVERYEP Q14145:p.Cys434Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:14:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:02:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys434ala' Tue Jun 30 16:18:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys434Ala' range MINT-2844599: original sequence: 434-434 : HIYAVGGSHGCIHHNSVERY Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-6 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Gly480Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:14:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:31:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly480ala' Tue Jun 30 16:06:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly480Ala' range MINT-2844628: original sequence: 480-480 : RLLYAVGGFDGTNRLNSAEC Q14145:p.Phe478Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:13:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe478ala' Tue Jun 30 15:54:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe478Ala' range MINT-2844625: original sequence: 478-478 : LNRLLYAVGGFDGTNRLNSA Q14145:p.Asp479Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:13:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:01:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp479ala' Tue Jun 30 16:12:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp479Ala' range MINT-2844631: original sequence: 479-479 : NRLLYAVGGFDGTNRLNSAE Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-7 2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Thr481Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:14:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:12:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr481ala' Tue Jun 30 18:16:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr481Ala' range MINT-2844657: original sequence: 481-481 : LLYAVGGFDGTNRLNSAECY Q14145:p.Asn482Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:53:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:56:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn482ala' Tue Jun 30 19:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn482Ala' range MINT-2844651: original sequence: 482-482 : LYAVGGFDGTNRLNSAECYY Q14145:p.Arg483Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:53:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:50:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg483ala' Tue Jun 30 18:22:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg483Ala' range MINT-2844654: original sequence: 483-483 : YAVGGFDGTNRLNSAECYYP Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-8 2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Gly527Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:53:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:11:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly527ala' Tue Jun 30 17:28:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly527Ala' range MINT-2844677: original sequence: 527-527 : NCIYAAGGYDGQDQLNSVER Q14145:p.Asp526Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:15:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:38:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp526ala' Tue Jun 30 17:13:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp526Ala' range MINT-2844680: original sequence: 526-526 : HNCIYAAGGYDGQDQLNSVE Q14145:p.Tyr525Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:13:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:43:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr525ala' Tue Jun 30 20:21:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr525Ala' range MINT-2844683: original sequence: 525-525 : LHNCIYAAGGYDGQDQLNSV Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-9 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Tyr572Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:52:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:54:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr572ala' Tue Jun 30 19:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr572Ala' range MINT-2844709: original sequence: 572-572 : HQGRIYVLGGYDGHTFLDSV Q14145:p.Gly574Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:11:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:31:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly574ala' Tue Jun 30 18:48:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly574Ala' range MINT-2844703: original sequence: 574-574 : GRIYVLGGYDGHTFLDSVEC Q14145:p.Asp573Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:52:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:26:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp573ala' Tue Jun 30 17:10:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp573Ala' range MINT-2844706: original sequence: 573-573 : QGRIYVLGGYDGHTFLDSVE Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-10 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Asn382Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:51:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:08:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn382ala' Tue Jun 30 19:13:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn382Ala' range MINT-2844732: original sequence: 382-382 : GLLYAVGGRNNSPDGNTDSS Q14145:p.Asn381Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:11:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:10:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn381ala' Tue Jun 30 16:10:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn381Ala' range MINT-2844735: original sequence: 381-381 : GGLLYAVGGRNNSPDGNTDS Q14145:p.Pro384Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:51:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:26:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro384ala' Tue Jun 30 19:58:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro384Ala' range MINT-2844752: original sequence: 384-384 : LYAVGGRNNSPDGNTDSSAL Q14145:p.Ser383Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:11:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:01:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser383ala' Tue Jun 30 19:54:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser383Ala' range MINT-2844729: original sequence: 383-383 : LLYAVGGRNNSPDGNTDSSA Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint keap1-nfe2l2-11 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2A F5C F5E EMBO-Journal homomint mint keap1-nfe2l2-12 6 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Tyr334Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:56:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr334ala' Tue Jun 30 17:36:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr334Ala' range MINT-2879965: original sequence: 334-334 : VGRLIYTAGGYFRQSLSYLE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6A EMBO-Journal homomint mint keap1-nfe2l2-13 6 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q14145:p.Gln337Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Tue Jul 12 10:56:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:11:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln337ala' Tue Jun 30 19:35:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln337Ala' range MINT-2879971: original sequence: 337-337 : LIYTAGGYFRQSLSYLEAYN tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6A EMBO-Journal homomint mint keap1-nfe2l2-14 6 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14145:p.Arg415Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:18:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:40:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg415ala' Tue Jun 30 15:44:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg415Ala' range MINT-2879993: original sequence: 415-415 : PCAPMSVPRNRIGVGVIDGH Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6A EMBO-Journal homomint mint nfe2l2-keap1 4 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2844836: original sequence: 315-359 : QVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADL Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6B EMBO-Journal homomint mint keap1-nfe2l2-15 7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q14145:p.Arg415Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:18:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:05:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg415ala' Tue Jun 30 16:17:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg415Ala' range MINT-2844764: original sequence: 415-415 : PCAPMSVPRNRIGVGVIDGH Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5G EMBO-Journal homomint mint