MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Adaptor functions of Cdc42, Ste50, and Sho1 in the yeast osmoregulatory HOG MAPK pathway. Adaptor functions of Cdc42, Ste50, and Sho1 in the yeast osmoregulatory HOG MAPK pathway. EMBO J. (0261-4189) 2006 imex curation Tatebayashi K., Yamamoto K., Tanaka K., Tomida T., Maruoka T., Kasukawa E., Saito H. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tatebayashi K., Yamamoto K., Tanaka K., Tomida T., Maruoka T., Kasukawa E., Saito H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Adaptor functions of Cdc42, Ste50, and Sho1 in the yeast osmoregulatory HOG MAPK pathway. Adaptor functions of Cdc42, Ste50, and Sho1 in the yeast osmoregulatory HOG MAPK pathway. EMBO J. (0261-4189) 2006 imex curation Tatebayashi K., Yamamoto K., Tanaka K., Tomida T., Maruoka T., Kasukawa E., Saito H. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Tatebayashi K., Yamamoto K., Tanaka K., Tomida T., Maruoka T., Kasukawa E., Saito H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation ste11_yeast Serine/threonine-protein kinase STE11 STE11 L8039.10 YLR362W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQTQTAEGTDLLIGDEKTNDLPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEKVSSLSTATLSMNSELIPEKHCVIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYTKNVLHLLYDVELVTICHANDRVEKNRLIFVSKDQTPSDKAISTSKKLYLRTLSALSQVGPSSSNLLAQNKGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRLQKTMRESFRHSARLSIAQRRPLSAESNNIGDILLKHSNAVDMALLQGLDQTRLSSKLDTTKIPKLAHKRPEDNDAISNQLELLSVESGEEEDHDFFGEDSDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHII E9E0DF27114EEEEF E9E0DF27114EEEEF sho1_yeast High osmolarity signaling protein SHO1 YER118C SHO1 SSU81 Osmosensor SHO1 Suppressor of SUA8-1 mutation Synthetic high osmolarity-sensitive protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSISSKIRPTPRKPSRMATDHSFKMKKFYADPFAISSISLAIVSWVIAIGGSISSASTNESFPRFTWWGIVYQFLIICSLMLFYCFDLVDHYRIFITTSIAVAFVYNTNSATNLVYADGPKKAAASAGVILLSIINLIWILYYGGDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGNRNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLHLNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEEMHR E467A4D50AA3EDB6 E467A4D50AA3EDB6 ste50_yeast Protein STE50 STE50 YCL32W YCL032W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEDGKQAINEGSNDASPDLDVNGTILMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKDDKTQEDMITVLKNLYTTTSAKLQEFQSQYTRLRMDVLDVMKTSSSSSPINTHGVSTTVPSSNNTIIPSSDGVSLSQTDYFDTVHNRQSPSRRESPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSHPSAVSTANTPGPSPNEALKQLRASKEDSCERILKNAMKRHNLADQDWRQYVLVICYGDQERLLELNEKPVIIFKNLKQQGLHPAIMLRRRGDFEEVAMMNGSDNVTPGGRL EFC7D14F2940C779 EFC7D14F2940C779 ste50-ssu81 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-2835950: original sequence: 145-367 : GDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGNRNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLHLNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEEMH ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2838556: original sequence: 1-236 : MEDGKQAINEGSNDASPDLDVNGTILMNNEDFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWKDDKTQEDMITVLKNLYTTTSAKLQEFQSQYTRLRMDVLDVMKTSSSSSPINTHGVSTTVPSSNNTIIPSSDGVSLSQTDYFDTVHNRQSPSRRESPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSH undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:35:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 146 range MINT-2835961: original sequence: 146-146 : QYTRLRMDVLDVMKTSSSSS Stoichiometry: 1.0 physical association physical association F5D EMBO-Journal As shown in Figure 5D (left panel), either GST-Ste50-D146F or GST-Ste50Delta1-D146F co-precipitated HA-Sho1C (lanes 4 and 5), while the wild-type GST-Ste50 or GST-Ste50Delta1 did not (lanes 2 and 3). GST-Ste50Delta4, which lacks the SAM and the central conserved domains, also did not bind HA-Sho1C. This pattern, as well as the location of the activating D146F mutation, suggests that the central conserved domain is important for Ste50 Sho1 binding. mint ssu81-ste50 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P40073:p.Arg342Gly mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Tue Jul 12 10:54:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:38:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg342gly' Tue Jun 30 19:33:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg342Gly' range MINT-2835993: original sequence: 342-342 : SDIEGRWWKARRANGETGII gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40073:p.Gly346Ser mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G S Tue Jul 12 10:15:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:50:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly346ser' Tue Jun 30 19:42:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly346Ser' range MINT-2835996: original sequence: 346-346 : GRWWKARRANGETGIIPSNY binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-2835978: original sequence: 145-367 : GDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGNRNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLHLNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEEMH Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5D EMBO-Journal More stable binding was observed when either the R342G or G346S mutation was included in the Sho1 SH3 domain (Figure 5D, lanes 11 13). Deletion of the Sho1 residues 145 218 weakened the Ste50 binding significantly (lane 12). mint ssu81-ste11 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836062: original sequence: 82-412 : IALGVNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEKVSSLSTATLSMNSELIPEKHCVIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYTKNVLHLLYDVELVTICHANDRVEKNRLIFVSKDQTPSDKAISTSKKLYLRTLSALSQVGPSSSNLLAQNKGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRLQKTMRESFRHSARLSIAQRRPLSAESNNIGDILLKHSNAVDMALLQGLDQTRLSSKLDTTKIPKLAHKRPEDNDAISNQLELLSVESGEE ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P40073:p.Arg342Gly mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Tue Jul 12 10:15:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:49:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg342gly' Tue Jun 30 16:09:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg342Gly' range MINT-2836014: original sequence: 342-342 : SDIEGRWWKARRANGETGII gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40073:p.Gly346Ser mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G S Tue Jul 12 10:58:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:09:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly346ser' Tue Jun 30 19:52:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly346Ser' range MINT-2836011: original sequence: 346-346 : GRWWKARRANGETGIIPSNY binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-2836017: original sequence: 145-367 : GDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGNRNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLHLNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDNFIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDGPEEMH Stoichiometry: 1.0 physical association physical association F5C F6C EMBO-Journal GST-Sho1 constructs without an activating mutation bound the HA-tagged Ste11 N-terminal domain (HA-Ste11N) (Figure 5D, lanes 15 17). In contrast, constructs with an activating mutation, namely GST-Sho1Delta1-R342G, GST-Sho1Delta2-R342G, and GST-Sho1Delta1-G346S, did strongly bind HA-Ste11N (Figure 5D, lanes 18 20). mint ste11-ssu81 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P40073:p.Arg342Gly mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Tue Jul 12 10:22:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:06:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg342gly' Tue Jun 30 18:59:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg342Gly' range MINT-2836053: original sequence: 342-342 : SDIEGRWWKARRANGETGII ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40073:p.Gly346Ser mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G S Tue Jul 12 10:22:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:32:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly346ser' Tue Jun 30 18:31:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly346Ser' range MINT-2836056: original sequence: 346-346 : GRWWKARRANGETGIIPSNY Stoichiometry: 1.0 physical association physical association F6A EMBO-Journal The wild-type Sho1 weakly bound to Ste11N, whereas the two SH3 domain mutants (R342G and G346S) bound to Ste11N more strongly (Figure 6A). mint ssu81-ste11-1 2 Ste11 3 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Sho1 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association F5 mint ssu81-ste50-1 2 Sho1 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Ste50 5 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association F5 mint