MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel apoptosis cascade mediated by lysosomal lactoferrin and its participation in hepatocyte apoptosis induced by D-galactosamine. A novel apoptosis cascade mediated by lysosomal lactoferrin and its participation in hepatocyte apoptosis induced by D-galactosamine. FEBS Lett. (0014-5793) 2006 imex curation Katunuma N., Le QT., Murata E., Matsui A., Majima E., Ishimaru N., Hayashi Y., Ohashi A. katunuma@tokushima.bunri-u.ac.jp 2009-01-08 Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Katunuma N., Le QT., Murata E., Matsui A., Majima E., Ishimaru N., Hayashi Y., Ohashi A. katunuma@tokushima.bunri-u.ac.jp FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation casp3_rat Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 LICE IRP Casp3 Cpp32 protein protein rat Rattus norvegicus (Rat) Rat MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH ADABF418E2507402 casp3-casp3 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role self self purified purified Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role self self purified purified Stoichiometry: 1.0 cleavage cleavage reaction cleavage F3 Procaspase- 3 was originally processed slowly via autocatalytic reaction kd 100 micromolar lactoferrin enhances the autocatalytic activation FEBS-Letters homomint mint