MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. EMBO J. (0261-4189) 2006 imex curation Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. EMBO J. (0261-4189) 2006 imex curation Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. 2009-01-08 Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. EMBO J. (0261-4189) 2006 imex curation Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. 2009-01-08 Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. EMBO J. (0261-4189) 2006 imex curation Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. 2009-01-08 Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy. EMBO J. (0261-4189) 2006 imex curation Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pontier SM., Lahaie N., Ginham R., St-Gelais F., Bonin H., Bell DJ., Flynn H., Trudeau LE., McIlhinney J., White JH., Bouvier M. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation gabr2_human Gamma-aminobutyric acid type B receptor subunit 2 G-protein coupled receptor 51 HG20 GABBR2 GPR51 GPRC3B protein protein human Homo sapiens Human MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL DIP protein O75899 original sequence version: 136 09F1773DB0673C5D gria2_human Glutamate receptor 2 GRIA2 GLUR2 AMPA-selective glutamate receptor 2 GluR-B GluR-K2 Glutamate receptor ionotropic, AMPA 2 protein protein human Homo sapiens Human MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI DIP protein P42262 original sequence version: 91 6DAB96C76D1D8448 gabr1_human Gamma-aminobutyric acid type B receptor subunit 1 GABBR1 GPRC3A protein protein human Homo sapiens Human MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK 54E7349CD02B633F nsf_human Vesicle-fusing ATPase N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF NSF protein protein human Homo sapiens Human MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD BF545A2A0C7EC2F7 gabbr2-nsf 1 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2791622: original sequence: 799-825 : RMKITELDKDLEEVTMQLQDTPEKTT tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1 EMBO-Journal A yeast two-hybrid screen (YTH) was performed with both GBR1 and GBR2 full-length c-tails (860I-961K and 741I-941L, respectively) against a human brain cDNA library. In addition to complementary GBR subunit (White et al, 2002) and transcription factor ATFx/CREB2 (White et al, 2000), we found NSF as a potential binding partner of GBR2 (Figure 1). homomint mint gabbr2-nsf-1 5 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2791704: original sequence: 799-825 : RMKITELDKDLEEVTMQLQDTPEKTT Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2A F2B F2C EMBO-Journal Conditions favoring NSF ATPase activity (ATP and Mg2+) disrupted the association, whereas its inhibition (ATPgammaS+Mg2+, ATP+EDTA or ATP+Mg2++EDTA) favored the interaction with GBR2ct. T pull-down performed with increasing amount of NSF in the presence of non-hydrolysable ATPgammaS (to inhibit ATPase activity) demonstrated a direct binding of NSF to GBR2ct (Figure 2A). homomint mint gria2-nsf-7 5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2791733: original sequence: 844-853 : EFCYKSRAEAKRMKVAKNAQNINPSSSQN Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2C EMBO-Journal Interestingly, Pep27 was as efficient as a previously described 10 amino-acid peptide corresponding to the GluR2 NSF binding site (Pep2m) homomint mint gabbr1-nsf 5 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2793114: original sequence: 860-961 : LITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLY Stoichiometry: 1.0 direct interaction direct interaction F2D EMBO-Journal In contrast to the results obtained in YTH experiments, NSF binding was not found to be restricted to GBR2ct and GBR1ct (854I-961K) also interacted selectively with NSF (Figure 2D). homomint mint gabbr1-nsf-1 2 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4 EMBO-Journal Figure 4 NSF co-localizes with both GBR subunits at the plasma membrane. homomint mint gabbr2-nsf-2 2 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4 EMBO-Journal Figure 4 NSF co-localizes with both GBR subunits at the plasma membrane. homomint mint gabbr1-nsf-2 4 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3A F5 EMBO-Journal mmunoprecipitation of GBR1 or GBR2 from cell expressing each of the receptor individually led to the co-sedimentation of NSF (Figure 3A and B). GABA stimulation disrupts the NSF/GBR complex. The NSF identifier is the human one although the experiment was conducted in CHO cells homomint mint gabbr1-gabbr2-5 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5 EMBO-Journal GABA stimulation disrupts the NSF/GBR complex. GBR1/GBR2 heterodimerization does not interfere with the NSF/GBR1 interaction. homomint mint gria2-nsf-8 3 9 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5 F3B EMBO-Journal mmunoprecipitation of GBR1 or GBR2 from cell expressing each of the receptor individually led to the co-sedimentation of NSF (Figure 3A and B). GABA stimulation disrupts the NSF/GBR complex.The NSF identifier is the human one although the experiment was conducted in CHO cells homomint mint nsf-gabbr2 3 9 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5 F3B EMBO-Journal mmunoprecipitation of GBR1 or GBR2 from cell expressing each of the receptor individually led to the co-sedimentation of NSF (Figure 3A and B). GABA stimulation disrupts the NSF/GBR complex.The NSF identifier is the human one although the experiment was conducted in CHO cells homomint mint