IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J. (0960-7412) 2006 imex curation Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Accepted 2006-JUN-7 by ORCHARD. Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J. (0960-7412) 2006 imex curation Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. The GUS reporter gene activity is presented in each interaction and this should be taken into account when deciding on the interaction affinity of the interactors. However because these interactions occur 'in planta' these results may be more credible than interactions detected using a 'classical' yeast two hybrid system. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Accepted 2006-JUN-7 by ORCHARD. Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation q9lw45_arath bZIP42 ATBZIP42 basic leucine-zipper 42 At3g30530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQPQTDVFSLHNYLNSSILQSPYPSNFPISTPFPTNGQNPYLLYGFQSPTNNPQSMSLSSNNSTSDEAEEQQTNNNIINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVLQENAQLKEETFELKQVISDMQIQSPFSCFRDDIIPIE 6DF62247849B99DF q8ru59_arath basic leucine-zipper 48 F3L12.14 F3L12_14 At2g04038 AtbZIP48 bZIP48 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIPAEINGYFQYLSPEYNVINMPSSPTSSLNYLNDLIINNNNYSSSSNSQDLMISNNSTSDEDHHQSIMVLDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQNCVLKENSKLKEEASDLRQLVCELKSNKNNNNSFPREFEDN 5549C4EEEACA19B5 bzip4_arath Basic leucine zipper 4 BZIP4 T4M14.10 At1g59530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFYTNMETVHNCFNDATITGDEIIDILAFLQSDESDNPSGINEVVPVDDKKRRRTISNRESAKRSRMKKKKRFEELTEEVNRLNIRNQELKNRLANVVSCGNFISRENNRLKTESVCLEIRLLELYRFLVAMQSPISTSVNYITTLEI 961C61572965DB22 bzp10_arath Basic leucine zipper 10 BZIP10 BZO2H1 Basic leucine zipper OPAQUE 2 homolog 1 T10P11.9 At4g02640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD 9C651436D8D167CF bzp63_arath Basic leucine zipper 63 BZIP63 BZO2H3 Basic leucine zipper OPAQUE 2 homolog 3 T32B20.4 At5g28770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKVFSDEEISGNHHWSVNGMTSLNRSASEWAFNRFIQESSAAADDGESTTACGVSVSSPPNVPVDSEEYRAFLKSKLNLACAAVAMKRGTFIKPQDTSGRSDNGGANESEQASLASSKATPMMSSAITSGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDASVENRVLKANIETLRAKVKMAEETVKRLTGFNPMFHNMPQIVSTVSLPSETSNSPDTTSSQVTTPEIISSGNKGKALIGCKMNRTASMRRVESLEHLQKRIRSVGDQ 37B85F20425DFF8B bzip1_arath Basic leucine zipper 1 BZIP1 K7J8.13 At5g49450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANAEKTSSGSDIDEKKRKRKLSNRESARRSRLKKQKLMEDTIHEISSLERRIKENSERCRAVKQRLDSVETENAGLRSEKIWLSSYVSDLENMIATTSLTLTQSGGGDCVDDQNANAGIAVGDCRRTPWKLSCGSLQPMASFKT 5137A1CCE8638C0A bzip9_arath Basic leucine zipper 9 BZIP9 BZO2H2 Basic leucine zipper OPAQUE 2 homolog 2 F6A4.10 At5g24800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNHTAKDIGMKRSASELALQEYLTTSPLDPCFDLMNRDYTCELRDSLLWSEGLFPAGPFRDAQSSICENLSADSPVSANKPEVRGGVRRTTSGSSHVNSDDEDAETEAGQSEMTNDPNDLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQQFRSAGTNNRVLKSDVETLRVKVKLAEDLVARGSLTSSLNQLLQTHLSPPSHSISSLHYTGNTSPAITVHSDQSLFPGMTLSGQNSSPGLGNVSSEAVSCVSDIWP 003617E73298544F bzp25_arath Basic leucine zipper 25 BZIP25 BZO2H4 Basic leucine zipper OPAQUE 2 homolog 4 T14E10.190 At3g54620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHIVFSVDDLTESFWPVPAPAPSPGSSSTPSPTQNVADGMTRSQSEWAFHRLINELSGSDSSPTTNTIERSPPPVQSLSRLEETVDETEDVVEIQKPQNHRRLPVDDQGKNRNRAPSSDPVDSSAPVVVDPNQYHAILKSKLELACAAVARRVGTVKPEDSSASASNQKQAQGSIVAQTSPGASSVRFSPTTSTQKKPDVPARQTSISSRDDSDDDDLDGDADNGDPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIPFSNTPSASSSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAPDSNLYETLPHWNHKH 1AF17B764F03F5A1 bzp11_arath bZIP transcription factor 11 BZIP11 ATB2 G-box-binding factor 6 GBF6 bZIP transcription factor ATB2 T4L20.170 At4g34590 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSSGTTSSTIQTSSGSEESLMEQRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENTEIVTSVSITTQHYLTVEAENSVLRAQLDELNHRLQSLNDIIEFLDSSNNNNNNNMGMCSNPLVGLECDDFFVNQMNMSYIMNQPLMASSDALMY 8A355CF86660E169 bzip2_arath bZIP transcription factor 2 BZIP2 FTM3 G-box-binding factor 5 GBF5 Protein FLORAL TRANSITION AT THE MERISTEM 3 At2g18160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSTYRSSSSSDGGNNNPSDSVVTVDERKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQAENSVLTAQMEELSTRLQSLNEIVDLVQSNGAGFGVDQIDGCGFDDRTVGIDGYYDDMNMMSNVNHWGGSVYTNQPIMANDINMY DA38B39D8D39ADA4 bzp44_arath bZIP transcription factor 44 BZIP44 F1B16.8 At1g75390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNNKTEMGSSTSGNCSSVSTTGLANSGSESDLRQRDLIDERKRKRKQSNRESARRSRMRKQKHLDDLTAQVTHLRKENAQIVAGIAVTTQHYVTIEAENDILRAQVLELNHRLQSLNEIVDFVESSSSGFGMETGQGLFDGGLFDGVMNPMNLGFYNQPIMASASTAGDVFNC 5B91C5D31304EAEF bzp53_arath bZIP transcription factor 53 BZIP53 T12C14.120 At3g62420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLQMQTSPESDNDPRYATVTDERKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDEASKKYIEMESKNNVLRAQASELTDRLRSLNSVLEMVEEISGQALDIPEIPESMQNPWQMPCPMQPIRASADMFDC 3DC0F19D229597EB q9lmy8_arath AtbZIP58 F13B4.8 bZIP58 basic leucine-zipper 58 F21F23.3 At1g13600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTIPAELTGYFHYLPPDKYNNQTPIMESEYFNMPSSPTSCSSFYHLNGLINNNNYSSSSNGQDLMTSNNSTSDEDHQQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSESHELALKENAKLKEETSDLRQLISEIKSHNEDDNSFLRELEDSISNSRSDSNQSGRDFELC EF11773033794D14 bzip1-bzip9 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip1-bzip10 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip1-bzip25 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip1-bzip63 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip2-bzip63 1 12 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip2-bzip9 1 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip2-bzip10 1 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip2-bzip25 1 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip11-bzip9 1 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip11-bzip10 1 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip11-bzip25 1 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip11-bzip63 1 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip44-bzip63 1 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip44-bzip9 1 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip44-bzip10 1 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip44-bzip25 1 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip53-bzip9 1 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip53-bzip10-1 1 14 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip53-bzip25 1 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip53-bzip63 1 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip11-bzip1 1 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip44-bzip1 1 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip1-bzip11 1 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip1-bzip44 1 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip25-bzip1 1 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip63-bzip1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip25-bzip2 1 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip63-bzip2 1 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip25-bzip11 1 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip63-bzip11 1 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip25-bzip44 1 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip63-bzip44 1 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip25-bzip53 1 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip1-bzip42 1 3 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip1-bzip58 1 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip1-bzip4 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip11-bzip58 1 11 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip44-bzip42 1 13 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip53-bzip58 1 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip42-bzip42 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip42-bzip58 1 15 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip58-bzip42 1 3 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score high author score author-based confidence author score Strong interaction '+'. Table 1 bzip58-bzip58 1 15 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip58-bzip48 1 4 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Weak interaction '(+)'. Table 1 bzip9-bzip9 2 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 4 GUS/NAN units standard deviation = 1. Table 2 bzip9-bzip10 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 28 GUS/NAN units standard deviation = 9. Table 2 bzip9-bzip25 2 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 19 GUS/NAN units standard deviation = 7. Table 2 bzip9-bzip63 2 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 18 GUS/NAN units standard deviation = 7. Table 2 bzip63-bzip9 2 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 10 GUS/NAN units standard deviation = 1. Table 2 bzip63-bzip10 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 71 GUS/NAN units standard deviation = 14. Table 2 bzip63-bzip25 2 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 10 GUS/NAN units standard deviation = 1. Table 2 bzip63-bzip63 2 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 11 GUS/NAN units standard deviation = 1. Table 2 bzip10-bzip9 2 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 4 GUS/NAN units standard deviation = 0. Table 2 bzip10-bzip10 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 2 GUS/NAN units standard deviation = 0. Table 2 bzip10-bzip25 2 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 4 GUS/NAN units standard deviation = 0. Table 2 bzip10-bzip63 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 7 (GUS/NAN units) standard deviation = 2. Table 2 bzip25-bzip10 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 8 GUS/NAN units standard deviation = 1. Table 2 bzip25-bzip9 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 12 GUS/NAN units standard deviation = 1. Table 2 bzip25-bzip25 2 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity =11 GUS/NAN units standard deviation = 1. Table 2 bzip25-bzip63 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 11 GUS/NAN units standard deviation = 0. Table 2 bzip9-bzip1 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 2 GUS/NAN units standard deviation = 0. Table 2 bzip9-bzip2 2 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 6 GUS/NAN units standard deviation = 2. Table 2 bzip9-bzip11 2 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 7 GUS/NAN units standard deviation = 3. Table 2 bzip9-bzip44 2 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 5 GUS/NAN units standard deviation = 2. Table 2 bzip9-bzip53 2 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 5 GUS/NAN units standard deviation = 1. Table 2 bzip10-bzip1 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 10 (GUS NAN units) standard deviation = 7. Table 2 bzip10-bzip2 2 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 9 GUS NAN units standard deviation = 7. Table 2 bzip10-bzip11 2 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 7 GUS NAN units standard deviation = 5. Table 2 bzip10-bzip44 2 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 6 GUS NAN units standard deviation = 4. Table 2 bzip10-bzip53 2 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 15 GUS NAN units standard deviation = 7. Table 2 bzip25-bzip1-1 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 30 GUS NAN units standard deviation = 4. Table 2 bzip25-bzip2-1 2 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 50 GUS NAN units standrard deviation = 7. Table 2 bzip25-bzip11-1 2 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 35 GUS NAN units standard deviation = 10. Table 2 bzip25-bzip44-1 2 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 25 GUS NAN units standard deviation = 6. Table 2 bzip25-bzip53-1 2 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 28 GUS NAN units standard deviation = 1. Table 2 bzip63-bzip1-1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 8 GUS NAN units standard deviation = 2. Table 2 bzip63-bzip2-1 2 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 11 GUS NAN units standard deviation = 3. Table 2 bzip63-bzip11-1 2 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 18 GUS NAN units standard deviation = 6. Table 2 bzip63-bzip44-2 2 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 13 GUS NAN units standard deviation = 8. Table 2 bzip63-bzip53 2 7 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 10 GUS NAN units standard deviation = 2. Table 2 bzip1-bzip9-1 2 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS ativity = 33 GUS NAN units standard deviation = 3. Table 2 bzip1-bzip10-1 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 271 GUS NAN units standard deviation = 18. Table 2 bzip1-bzip25-1 2 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 74 GUS NAN units standard deviation = 19. Table 2 bzip1-bzip63-1 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 13 GUS NAN units standard deviation = 1. Table 2 bzip1-bzip1 2 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 2 GUS NAN units standard deviation = 0. Table 2 bzip1-bzip2 2 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 4 GUS NAN units standard deviation = 3. Table 2 bzip1-bzip11-1 2 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 17 GUS NAN units standard deviation = 8. Table 2 bzip1-bzip44-1 2 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 9 GUS NAN units standard deviation = 4. Table 2 bzip1-bzip53 2 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 7 GUS NAN units standard deviation = 6. Table 2 bzip2-bzip9-1 2 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 55 GUS NAN units standard deviation = 0. Table 2 bzip2-bzip10-1 2 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 63 GUS NAN units standard deviation = 6. Table 2 bzip2-bzip25-1 2 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 207 GUS NAN units standard deviation = 14 . Table 2 bzip2-bzip63-1 2 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS ativity = 50 GUS NAN units standard deviation = 0. Table 2 bzip2-bzip1 2 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 13 GUS NAN units standard devaition = 3. Table 2 bzip2-bzip2 2 12 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 16 GUS NAN units standard devaition = 0. Table 2 bzip2-bzip11 2 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 41 GUS NAN units standard deviation = 13. Table 2 bzip2-bzip44 2 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 10 GUS NAN units standard deviation = 1. Table 2 bzip2-bzip53 2 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 56 GUS NAN units standard deviation = 13. Table 2 bzip11-bzip9-1 2 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 134 GUS NAN units standard deviation = 16. Table 2 bzip11-bzip10-1 2 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 345 GUS NAN units standard deviation = 4. Table 2 bzip11-bzip25-1 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 500 GUS NAN units standard deviation = 8. Table 2 bzip11-bzip63-1 2 11 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 172 GUS NAN units standard deviation = 20. Table 2 bzip11-bzip1-1 2 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 21 GUS NAN units standard deviation = 4. Table 2 bzip11-bzip2 2 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 68 GUS NAN units standard deviation = 17. Table 2 bzip11-bzip11 2 11 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 30 GUS NAN units standard deviation = 3. Table 2 bzip11-bzip44 2 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 12 GUS NAN units standard deviation = 2. Table 2 bzip11-bzip53 2 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 36 GUS NAN units standard deviation = 0. Table 2 bzip44-bzip9-1 2 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 16 GUS/NAN units standard deviation = 4. Table 2 bzip44-bzip10-1 2 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 49 GUS NAN units standard deviation = 0. Table 2 bzip44-bzip25-1 2 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 189 GUS NAN units standard deviation = 8. Table 2 bzip44-bzip63-1 2 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 15 GUS NAN units standard deviation = 2. Table 2 bzip44-bzip1-1 2 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 3 GUS NAN units standard deviation = 0. Table 2 bzip44-bzip2 2 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 3 GUS NAN units standard deviation = 1. Table 2 bzip44-bzip11 2 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 3 GUS NAN units standard deviation = 1. Table 2 bzip44-bzip44 2 13 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 2 GUS NAN units standard deviation = 2. Table 2 bzip44-bzip53 2 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 4 GUS NAN units standard deviation = 0. Table 2 bzip53-bzip1 2 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 8 GUS NAN units standard deviation = 1. Table 2 bzip53-bzip2 2 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 17 GUS NAN units standard deviation = 5. Table 2 bzip53-bzip11 2 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 29 GUS NAN units standard deviation = 5. Table 2 bzip53-bzip44 2 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 13 GUS NAN units standard deviation = 3. Table 2 bzip53-bzip53 2 14 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 6 GUS NAN units standard deviation = 0. Table 2 bzip53-bzip9-1 2 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 102 GUS NAN units standard deviation = 4. Table 2 bzip53-bzip10 2 6 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score GUS activity = 176 GUS NAN units standard deviation = 35. Table 2 bzip53-bzip25-1 2 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 150 GUS NAN units standard deviation = 34. Table 2 bzip53-bzip63-1 2 14 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score GUS activity = 33 GUS NAN units standard deviation = 12. Table 2