MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. FEBS Lett. (0014-5793) 2006 imex curation Tsuda M., Seong KH., Aigaki T. 2009-01-08 Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. FEBS Lett. (0014-5793) 2006 imex curation Tsuda M., Seong KH., Aigaki T. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. FEBS Lett. (0014-5793) 2006 imex curation Tsuda M., Seong KH., Aigaki T. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation q7k2l7_drome Dmel\CG17765 CG17765 Dmel_CG17765 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSYGQGYNPYAQPGGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCSY 1747E5B5957CCB42 q9vb05_drome ALiX AIP1 ALIX Aip1 Alix DAIP1 Dmel\CG12876 Snf7 alix Dmel_CG12876 CG12876 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKFLGVPLKKPSEVDVIKPLNNLIQSTYNGASEEEKGKYGEAVNEFSKQRNTAIWKFFEKYEASLEIVYAYYDQICALETKISVSELQIPFKWKDAFDKGSIFGGKISLTHTSLLYEKVCVLFNIAALQSNIAANQSLDSDDGLKLTIKLLQQSAGIFQYLKGATPAAVPSEPTPDLSQDTLTVLQALMVAQAQEVFILKAIKDNLKDQIIAKLCCQAEESYADVLRAMQKESVRSLWEKEWIPTIAGKQAGFHALTQLYQSLVCRAAKKIGEEIARLRNAIDLFKAAQTRSGNETYLDEYFSRAKRNLTESTKDNEFIYNEIIPELSTLTSPGKAQLAKPLPIAVPLAENFKDIFSSLVPVELHRALTASDMRRNEIVNVEIMKLREATQTLNAVLASLNLPAAVETADGNSGLPPSLKEKANEVRQKGGIENVQTMLKDLPELLNRNREILDETERLLDEERDSDNQLRAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKLMDDVETIKAEREAIESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQNKISDFVFARKTEKEELLKDLTTESSRQACPATPALPSHYASTSGSGSDIPPGSAPSVPPAASTANIPYPAQVQGMPIPYGAQPGVPYPAYVPAPMPQSFNPYATLPYPGNYQYQGFPQGPPPGHYGTYPGSYANQQGGYPNQKPPGW 0E02FEDA6B9CF4DD q9nhp2_drome RING-type E3 ubiquitin transferase POSH CG4909 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDEHTLNDLLECSVCLERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKIDELPPNVLLMRILEGMKQNAAAGKGEEKGEETETQPERAKPQPPAESVAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLPMPQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVELNAAAKKLLDSGLHTHPLCHPPKQQGQRALPPVPVIDPTVVTESSSGSSNSTPGSSNSSSTSSSNNCSPNHQISLPNTPQHVVASGSASVRFRDKGAKEKRHSLNALLGGGAPLSLLQTNRHSAEILSLPHELSRLEVSSSTALKPTSAPQTSRVLKTTVQQQMQPNLPWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYLTPLRARDQQQLMHQWKYVPQNADAQMAQVQQHPVAPDVRLNNMLSMQPPDLPPRQQQATATTTSCSVWSKPVEALFSRKSEPKPDTATASTTSSSSSGAVGLMRRLTHMKTRSKSPGASLQQVPKEAISTNVEFTTNPSAKLHPVHVRSGSCPSQLQHSQPLNETPAAKTAAQQQQFLPKQLPSASTNSVSYGSQRVKGSKERPHLICARQSLDAATFRSMYNNAASPPPPTTSVAPAVYAGGQQQVIPGGGAQSQLHANMIIAPSHRKSHSLDASHVLSPSSNMITEAAIKASATTKSPYCTRESRFRCIVPYPPNSDIELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVEPDC mint 2D0C36CAF93C6397 q9vbm1_drome MLC1 BcDNA:AT16150 CG5024-RA Dmel\CG5024 gene1 CG5024 Dmel_CG5024 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDDFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMMMET E7B8C58C9A73F758 posh-q7k2l7 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA a full-length POSH cDNA fused to the GAL4 DNA binding domain as bait. Sequence analysis of the library inserts revealed two independent clones that contained an open reading frame of a Drosophila homolog of ALG-2. FEBS-Letters mint alix-posh 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A the GST ALIX fusion protein was able to bind to POSH (Fig. 1A). FEBS-Letters homomint mint alix-cg5024_ra 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F1C Furthermore, the GST ALIX protein was also able to bind to ALG-2, but only in the presence of calcium (Fig. 1B). GST ALIX protein was also able to bind to ALG-2, but only in the presence of calcium. FEBS-Letters mint posh-alix 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain proline rich range MINT-2568887: original sequence: 472-836 : RAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKLMDDVETIKAEREAIESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQNKISDFVFARKTEKEELLKDLTTESSRQACPATPALPSHYASTSGSGSDIPPGSAPSVPPAASTANIPYPAQVQGMPIPYGAQPGVPYPAYVPAPMPQSFNPYATLPYPGNYQYQGFPQGPPPGHYGTYPGSYANQQGGYPNQKPPG Stoichiometry: 1.0 physical association physical association F1B The C-terminal half of ALIX bound to both GST POSH and GST ALG-2, whereas the N-terminal half did not bind to either GST fusion protein. These results indicate that the C-terminal half of ALIX containing the proline-rich region is responsible for the binding to both POSH and ALG-2 (Fig. 1C). FEBS-Letters homomint mint q7k2l7-alix 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain proline rich range MINT-2569114: original sequence: 472-836 : RAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKLMDDVETIKAEREAIESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQNKISDFVFARKTEKEELLKDLTTESSRQACPATPALPSHYASTSGSGSDIPPGSAPSVPPAASTANIPYPAQVQGMPIPYGAQPGVPYPAYVPAPMPQSFNPYATLPYPGNYQYQGFPQGPPPGHYGTYPGSYANQQGGYPNQKPPG Stoichiometry: 1.0 physical association physical association F1B The C-terminal half of ALIX bound to both GST POSH and GST ALG-2, whereas the N-terminal half did not bind to either GST fusion protein. These results indicate that the C-terminal half of ALIX containing the proline-rich region is responsible for the binding to both POSH and ALG-2 (Fig. 1C). FEBS-Letters mint posh-alix-1 1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1D Both ALG-2 and ALIX co-precipitated with the anti-POSH antibody (Fig. 1D). FEBS-Letters homomint mint posh-q7k2l7-1 1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1D Both ALG-2 and ALIX co-precipitated with the anti-POSH antibody (Fig. 1D). FEBS-Letters mint