MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Analysis of leptin signalling in hematopoietic cells using an adapted MAPPIT strategy. Analysis of leptin signalling in hematopoietic cells using an adapted MAPPIT strategy. FEBS Lett. (0014-5793) 2006 imex curation Montoye T., Piessevaux J., Lavens D., Wauman J., Catteeuw D., Vandekerckhove J., Lemmens I., Tavernier J. 2009-01-08 Only protein-protein interactions mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 pull down pull down predetermined predetermined participant predetermined Montoye T., Piessevaux J., Lavens D., Wauman J., Catteeuw D., Vandekerckhove J., Lemmens I., Tavernier J. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation Analysis of leptin signalling in hematopoietic cells using an adapted MAPPIT strategy. Analysis of leptin signalling in hematopoietic cells using an adapted MAPPIT strategy. FEBS Lett. (0014-5793) 2006 imex curation Montoye T., Piessevaux J., Lavens D., Wauman J., Catteeuw D., Vandekerckhove J., Lemmens I., Tavernier J. 2009-01-08 Only protein-protein interactions mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Montoye T., Piessevaux J., Lavens D., Wauman J., Catteeuw D., Vandekerckhove J., Lemmens I., Tavernier J. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL DIP protein O35718 original sequence version: 61 DIP protein O35718 original sequence version: 119 DIP protein O35718 original sequence version: 93 CD3859561D4CCDED socs2_mouse Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 Socs2 Cis2 Cish2 protein protein mouse Mus musculus Mouse MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWGLPLPTRLKDYLEEYKFQV C9051AE9C84BA7F5 sta5a_mouse Signal transducer and activator of transcription 5A Mammary gland factor Stat5a Mgf Mpf protein protein mouse Mus musculus Mouse MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNCSSPAGVLVDAMSQKHLQINQRFEELRLITQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIKQVVPEFVNASTDAGASATYMDQAPSPVVCPQPHYNMYPPNPDPVLDQDGEFDLDESMDVARHVEELLRRPMDSLDARLSPPAGLFTSARSSLS 7C66E435C37624DD plcg1_mouse 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 Plcg1 Plcg-1 Phosphoinositide phospholipase C-gamma-1 Phospholipase C-gamma-1 protein protein mouse Mus musculus Mouse MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNALRTGERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLRRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASSSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMINPAVLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKENGDLSPFSGISLRERASDASSQLFHVRAREGSFEARYQQPFEDFRISQEHLADHFDSRERSTSDGPSSATNLIEDPLHDKLWKCSL DIP protein Q62077 original sequence version: 129 5D123C508D425EB2 cish_mouse Cytokine-inducible SH2-containing protein CIS-1 Suppressor of cytokine signaling Cish Cis protein protein mouse Mus musculus Mouse MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL F14FD8B370B9A005 socs6_mouse Suppressor of cytokine signaling 6 Socs6 Cis4 Cish4 Socs4 Suppressor of cytokine signaling 4 Cytokine-inducible SH2 protein 4 protein protein mouse Mus musculus Mouse MKKISLKTFRKSFNLSKSKDETEFMVVQPQSLAGDFVKDDSLFGSCYGKDMASCDIGSEDEKGKNRSKSESLMGTLKRRLSAKQKTKGKGGTASTDEDTFSSASAPGGLKDVRAPRPIRSTSLRSHHYSPTPWPLRPTSSEETCIKMEMRVKALVHAASPGPVNGVRKDLRELQPRELRDLQPEPRPESRCSPSSPGDLSLHLEEHVPVVIGLMSQDYLQYTVPLDDGMCPLEGPRSCCLDTSSPMEVSAVPLPGASGAFSEDDSHVDQDLVVGPEILVDSSVNNLLIGTTGVMLQSPRGGHDDAPPLSPLLPPMQNNPIQRNFSGLSGPDLHMAESVRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins mint F779C6519DB0A17B socs7_mouse Suppressor of cytokine signaling 7 Socs7 Cish7 Nap4 protein protein mouse Mus musculus Mouse MVFRNVGRPPEEEDAEAAREPGPSELLCPRHRCALDPKALPPGLALERTWGPVAGLEAQLAALGLGQPAGPGIKTAGGGCCPCPCPPQPPPPQPPPPAAAPQAGEDPTETSDALLVLEGLESEAESLETNSCSEEELSSPGRGGGGVGGRLLLQPPGPELPPVPFPLQDLVPPGRLSRGEQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGDLAASAASLTDMGGSAVRELDTGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRASESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST Regulates signaling cascades probably through protein ubiquitination and/or sequestration. Functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. Inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. May be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins mint FAB66BF2A0BE685A lepr_mouse Leptin receptor Lepr Db Obr OB receptor B219 protein protein mouse Mus musculus Mouse MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDDSFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTDNTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVREAAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILTSVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVKVPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVGNRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVILSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKHAESVIFGPLLLEPEPISEEISVDTAWKNKDEMVPAAMVSLLLTTPDPESSSICISDQCNSANFSGSQSTQVTCEDECQRQPSVKYATLVSNDKLVETDEEQGFIHSPVSNCISSNHSPLRQSFSSSSWETEAQTFFLLSDQQPTMISPQLSFSGLDELLELEGSFPEENHREKSVCYLGVTSVNRRESGVLLTGEAGILCTFPAQCLFSDIRILQERCSHFVENNLSLGTSGENFVPYMPQFQTCSTHSHKIMENKMCDLTV DIP protein P48356 original sequence version: 111 DIP protein P48356 original sequence version: 144 0E1E75B076BA60A2 lepr-plcg1 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 Analysis using the GGS-LR Y985 and GGS-LR Y1077 baits revealed that both preys only interact with the Y1077 motif (Fig. 3B). Strong luciferase signals were detected with the PLCγ-prey, and a weaker interaction was seen with the STAT5a-prey (Fig. 3A). Analysis using the GGS-LR Y985 and GGS-LR Y1077 baits revealed that both preys only interact with the Y1077 motif (Fig. 3B). FEBS-Letters homomint mint lepr-socs3 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2 Interaction occurs also in TF1-M1-16 cells. SOCS3 strongly binds to the LR pY985-motif and negatively regulates LR signalling [18]. To suppress its inhibitory effect on JAK2 activation, we inactivated the Kinase Inhibitory Region (KIR domain) in the SOCS3 prey by introducing a F25A mutation. SV40 large T protein (SVT) was used as negative prey control. As shown in Fig. 2, clear, specific signals were obtained in both Ba/F3 and TF1-M1-16 cells with either the LR(YYF) lacking the Y1138 STAT recruitment motif or with a GGS-bait construct containing only the LR Y985 motif. FEBS-Letters homomint mint lepr-stat5a 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 Analysis using the GGS-LR Y985 and GGS-LR Y1077 baits revealed that both preys only interact with the Y1077 motif (Fig. 3B). Strong luciferase signals were detected with the PLCγ-prey, and a weaker interaction was seen with the STAT5a-prey (Fig. 3A). Analysis using the GGS-LR Y985 and GGS-LR Y1077 baits revealed that both preys only interact with the Y1077 motif (Fig. 3B). FEBS-Letters mint lepr-cish 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4 A detailed binding analysis of SOCS preys showed that SOCS3 interacted with the Y985 motif, while SOCS2 and -6 bind to the Y1077 motif. CIS and SOCS7 can interact with both motifs (Fig. 4C). FEBS-Letters homomint mint lepr-socs6 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4 A detailed binding analysis of SOCS preys showed that SOCS3 interacted with the Y985 motif, while SOCS2 and -6 bind to the Y1077 motif. CIS and SOCS7 can interact with both motifs (Fig. 4C). FEBS-Letters homomint mint lepr-socs2 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4 A detailed binding analysis of SOCS preys showed that SOCS3 interacted with the Y985 motif, while SOCS2 and -6 bind to the Y1077 motif. CIS and SOCS7 can interact with both motifs (Fig. 4C). FEBS-Letters homomint mint lepr-socs7 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4 A detailed binding analysis of SOCS preys showed that SOCS3 interacted with the Y985 motif, while SOCS2 and -6 bind to the Y1077 motif. CIS and SOCS7 can interact with both motifs (Fig. 4C). FEBS-Letters homomint mint lepr-plcg1-1 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain range MINT-2790474: original sequence: 1077-1077 : STMRDEAFDPFDKSSLRGLE binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2790472: original sequence: 1069-1085 : MRDEAFDPFDKSSLRG Stoichiometry: 1.0 10 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tagged biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3C No detectable binding was observed with the non-phosphorylated peptides. Clear binding was observed with the pY1077 phospho-peptide, with only minor binding to the pY985 motif. No detectable binding was observed with the non-phosphorylated peptides (Fig. 4B). FEBS-Letters homomint mint