IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. jianminli@njmu.edu.cn Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. jianminli@njmu.edu.cn Accepted 2006-JUN-7 by ORCHARD. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. jianminli@njmu.edu.cn Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. Figure 6 jianminli@njmu.edu.cn Accepted 2006-JUN-7 by ORCHARD. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation tpd55_human Tumor protein D55 Tumor protein D52-like 3 Testis development protein NYD-SP25 TPD52L3 protein protein human Homo sapiens Human MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP 759F26E983B1EFAD q68e05_human DKFZp686A1765 TPD52L2 hCG_22755 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF 002CD68479D8250C o43399-2 Tumor protein D54 HD54-ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF 002CD68479D8250C o43399-1 Tumor protein D54 HD54+ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF 58F01BC67B1E3DE9 tpd53_human Tumor protein D53 Tumor protein D52-like 1 TPD52L1 protein protein human Homo sapiens Human MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC 6B3C336D5C0653C9 mal2_human Protein MAL2 MAL2 protein protein human Homo sapiens Human MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP BACDA0BF3A26FD44 tpd52_human Tumor protein D52 Protein N8 TPD52 protein protein human Homo sapiens Human MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL 4C8183C5914BB976 nyd_sp25-tpd52 1 3 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score score = ++++ nyd_sp25-tpd53 1 3 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score score = +++ nyd_sp25-nyd_sp25 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score score = ++ nyd_sp25-tpd54 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score score = + nyd_sp25-tpd54-1 2 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction mal2-tpd52-1 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Positive control nyd_sp25-tpd54-2 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction