MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of Moloney murine leukemia virus matrix protein with IQGAP. Interaction of Moloney murine leukemia virus matrix protein with IQGAP. EMBO J. (0261-4189) 2006 imex curation Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Interaction of Moloney murine leukemia virus matrix protein with IQGAP. Interaction of Moloney murine leukemia virus matrix protein with IQGAP. EMBO J. (0261-4189) 2006 imex curation Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Interaction of Moloney murine leukemia virus matrix protein with IQGAP. Interaction of Moloney murine leukemia virus matrix protein with IQGAP. EMBO J. (0261-4189) 2006 imex curation Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung J., Yueh A., Appah FS., Yuan B., de los Santos K., Goff SP. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation iqga1_mouse Ras GTPase-activating-like protein IQGAP1 Iqgap1 protein protein mouse Mus musculus Mouse MSAAEEVDGLGVVRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRVAADTFTALKNPNAMLVNLEEGLAPTYQDVLYQAKQDKMTNAKNRTENSDRERDVYEELLTQAEIQGNVNKVNTSSALANISLALEQGCAVTLLKALQSLALGLRGLQTQNSDWYMKQLQSDLQQKRQSGQTDPLQKEEVQAGVDAANSAAQQYQRRLAAVAAINAAIQKGIAEKTVLELMNPEAQLPQVYPFAADLYQKELATLQQQSPEHSLTHPELTVAVEMLSSVALINRALESGDMTTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNAFITWNDIQACVDHVNLVVHEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQETQDESAVLWLDEIQGGIWQSNKDTQEAQRFALGISAINEAVDSGDVGRTLSALRSPDVGLYGVIPECGETYQSDLAEAKKKRLAAGDNNSKWVKHWVKGGYHYYHNLETQAGGWAEPPDFVQNSVQLSREEIQSSISGVTAAYNREQLWLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLHSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFQTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVKTRLDNSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQVACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGESCGNSNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPGETLTEILETPATNEQEAEHQRAMQRRAIRDAKTPDKMKKSKPMKEDNNLSLQEKKEKIQTGLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRKAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK 9136695557ADA784 dnja1_mouse DnaJ homolog subfamily A member 1 Heat shock 40 kDa protein 4 DnaJ protein homolog 2 Heat shock protein J2 Dnaja1 Dnaj2 Hsj2 Hspf4 protein protein mouse Mus musculus Mouse MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS DIP protein P63037 original sequence version: 64 1783CE3D5C4CD558 tkt_mouse Transketolase P68 Tkt protein protein mouse Mus musculus Mouse MEGYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKALDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLPEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCMLGDGEVSEGSVWEAMAFAGIYKLDNLVAIFDINRLGQSDPAPLQHQVDIYQKRCEAFGWHTIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGIEDKEAWHGKPLPKNMAEQIIQEIYSQVQSKKKILATPPQEDAPSVDIANIRMPTPPSYKVGDKIATRKAYGLALAKLGHASDRIIALDGDTKNSTFSELFKKEHPDRFIECYIAEQNMVSIAVGCATRDRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSVPMSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYSNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAESLKKDKISIRVLDPFTIKPLDRKLILDSARATKGRILTVEDHYYEGGIGEAVSAAVVGEPGVTVTRLAVSQVPRSGKPAELLKMFGIDKDAIVQAVKGLVTKG 870045AD5C58FA09 vav_mouse Proto-oncogene vav Vav1 p95vav Vav protein protein mouse Mus musculus Mouse MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREVNLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRLESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNIEELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKTDRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQGYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVHGPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKIMTSEGLYRITEKKAFRGLLELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPPAGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYC DIP protein P27870 original sequence version: 120 DIP protein P27870 original sequence version: 141 3666DCCD1C5229DA dok3_mouse Docking protein 3 Dok3 Dokl Downstream of tyrosine kinase 3 p62(dok)-like protein protein protein mouse Mus musculus Mouse MESVEPPVKDGILYQQHVKFGKKCWRKVWALLYAGGPSGVARLESWDVRDGGLGPAGDRSTGPSRRGERRVIRLADCVSVLPADGESCPRDTGAFLITTTERSHLLAAQHRQSWVDPICQLAFPGTGECSSGSGQAESPKRGFVPMEENSIYSSWQEVTEFPVIVQRTEATSRCQLKGPYLLVLGQDDIQLRETSKPQACFSWPYRFLRKYGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGVVAAAIARQRERLPELAMSPPCPLPRALSLPSLEPPGELREVAPGFELPTPRKLPLTDPGPQSLPLLLSPTQEGPASGLYASVCKQTSKHTGTAEHLYENVCMLEASPGLTNGGPEAQEGPPGGRSPLGSPIYHNTEDLSWPGSAQDSNLEAQYRRLLELELDEAGSAGRSGAQAGIKAKLVTLLTRERKKGPAPCDRP 124B705712202D9B gag_mlvms Gag polyprotein gag Core polyprotein protein protein mlvms Moloney murine leukemia virus (isolate Shinnick) (MoMLV) MGQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGAKPKPQVLSDSGGPLIDLLTEDPPPYRDPRPPPSDRDGNGGEATPAGEAPDPSPMASRLRGRREPPVADSTTSQAFPLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERRRTEDEQKEKERDRRRHREMSKLLATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLLTLDD 8A7652439B464495 gag-iqgap1 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:20:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 60-62 range MINT-2490942: original sequence: 60-62 : WPRDGTFNRDLITQVKIKVFSP matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741898: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-iqgap1-1 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741902: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:25:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 63-65 range MINT-2490952: original sequence: 63-65 : DGTFNRDLITQVKIKVFSPGPH tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-iqgap1-2 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741906: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:24:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 81-83 range MINT-2490974: original sequence: 81-83 : PGPHGHPDQVPYIVTWEALAFD Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-vav1 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741914: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:25:38 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 54-56 range MINT-2490996: original sequence: 54-56 : PTFNVGWPRDGTFNRDLITQVK Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-iqgap1-3 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741919: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:51:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 88-91 range MINT-2491018: original sequence: 88-91 : DQVPYIVTWEALAFDPPPWVKPF Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-iqgap1-4 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:52:28 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 84-87 range MINT-2491040: original sequence: 84-87 : HGHPDQVPYIVTWEALAFDPPPW matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741949: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-vav1-1 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741924: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:49:32 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 84-87 range MINT-2491076: original sequence: 84-87 : HGHPDQVPYIVTWEALAFDPPPW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-tkt 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741910: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-dok3 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:50:22 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 68-70 range MINT-2491157: original sequence: 68-70 : RDLITQVKIKVFSPGPHGHPDQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741929: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-dok3-1 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:22 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 71-73 range MINT-2491163: original sequence: 71-73 : ITQVKIKVFSPGPHGHPDQVPY matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741934: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-dok3-2 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 89-92 range MINT-2491185: original sequence: 89-92 : QVPYIVTWEALAFDPPPWVKPFV tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741939: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. homomint mint gag-dnaja1 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741944: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 EMBO-Journal To identify the residues of MA required for the interaction with IQGAP1 or the other binding proteins, a series of alanine substitution mutations were introduced into the central portion of the MA coding region in the LexADB-MA construct(Figure 1A).The mutants were tested for their interaction with various Gal4AD fusions identified in the screen (Table I).Binding to IQGAP1 was sensitive to a distinctive set of mutations localized in twoblocks: mutants T1 T6, and mutants T11, SMA6, and SMA8. mint gag-iqgap1-5 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741957: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491276: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 1641-1657 range MINT-2491279: original sequence: 1641-1657 : VNVNLLIFLLNKKFYG Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-6 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741961: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491302: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:46 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1518-1522 range MINT-2491300: original sequence: 1518-1522 : QTYSALNSKATFYGEQVDYYKSYI tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-7 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741973: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:46:33 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 1515-1518 range MINT-2491323: original sequence: 1515-1518 : KLQQTYSALNSKATFYGEQVDYY tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491325: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-8 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491371: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:47:18 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1523-1526 range MINT-2491369: original sequence: 1523-1526 : LNSKATFYGEQVDYYKSYIKTCL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741969: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-9 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741965: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:46:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1554-1557 range MINT-2491394: original sequence: 1554-1557 : VSKKPREMKGKKSKKISLKYTAA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491396: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-10 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741953: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491422: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1550-1553 range MINT-2491420: original sequence: 1550-1553 : SKGKVSKKPREMKGKKSKKISLK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-11 2 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741977: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:29 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1546-1549 range MINT-2491444: original sequence: 1546-1549 : DNLASKGKVSKKPREMKGKKSKK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491446: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-12 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2491470: original sequence: 1500-1657 : KAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYG tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:04:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 1542-1545 range MINT-2491468: original sequence: 1542-1545 : KTCLDNLASKGKVSKKPREMKGK Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741981: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 physical association physical association F3 EMBO-Journal The minimal region required for strong interaction with MA consisted of residues 1500 1657, including the C-terminus of the protein (Figure 3A). Mutants mt5, 6, and 7 near the N-terminal border showed strongly reduced binding (though mutant mt8 did not); and mutants mt9, 10, 11, and 12 at the very C-terminus were all completely defective for binding, suggesting that the C-terminus of IQGAP1 is essential for the interaction (Figure 3B). mint gag-iqgap1-13 1 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741985: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:01:50 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 60-62 range MINT-2491604: original sequence: 60-62 : WPRDGTFNRDLITQVKIKVFSP tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal (Figure 4B). Wild-type Gag bound the full-length IQGAP1 and the C-terminal fragment efficiently, while the T4 mutant Gag bound them much less well. mint gag-iqgap1-14 3 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741888: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:02:38 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 60-62 range MINT-2491521: original sequence: 60-62 : WPRDGTFNRDLITQVKIKVFSP Stoichiometry: 1.0 direct interaction direct interaction F4A EMBO-Journal (Figure 4A). Wild-type MBP-MA efficiently bound GST-IQGAP1, but not GST, from solution. MA mutants T4, T5, SMA6, and T11 bound GST-IQGAP1 very poorly or not at all. mint gag-iqgap1-15 3 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:07:44 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 63-65 range MINT-2491538: original sequence: 63-65 : DGTFNRDLITQVKIKVFSPGPH matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741883: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4A EMBO-Journal (Figure 4A). Wild-type MBP-MA efficiently bound GST-IQGAP1, but not GST, from solution. MA mutants T4, T5, SMA6, and T11 bound GST-IQGAP1 very poorly or not at all. mint gag-iqgap1-16 3 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Matrix protein 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified matrix protein Matrix protein polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain range MINT-6741893: original sequence: 2-131 : GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPPPLPPSAPSLPLEPPRSTPPRSSL undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:08:30 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 81-83 range MINT-2491552: original sequence: 81-83 : PGPHGHPDQVPYIVTWEALAFD Stoichiometry: 1.0 direct interaction direct interaction F4A EMBO-Journal (Figure 4A). Wild-type MBP-MA efficiently bound GST-IQGAP1, but not GST, from solution. MA mutants T4, T5, SMA6, and T11 bound GST-IQGAP1 very poorly or not at all. mint