IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Cell (0092-8674) 2006 imex curation Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. 1B yasushi@nict.go.jp Accepted 2006-MAY-18 by DAVET. cDNAs expressed in response to mating pheromone used. Cell (0092-8674) 2006 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 imex curation Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Cell (0092-8674) 2006 imex curation Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. 3, 4D, 4E, 4F yasushi@nict.go.jp Accepted 2006-MAY-17 by DAVET. Cell (0092-8674) 2006 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 imex curation Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Cell (0092-8674) 2006 imex curation Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. 1B, 4A yasushi@nict.go.jp Accepted 2006-MAY-17 by DAVET. Cell (0092-8674) 2006 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 imex curation Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Cell (0092-8674) 2006 imex curation Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. 4B yasushi@nict.go.jp Accepted 2006-MAY-17 by DAVET. Cell (0092-8674) 2006 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 imex curation Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Meiotic proteins bqt1 and bqt2 tether telomeres to form the bouquet arrangement of chromosomes. Cell (0092-8674) 2006 imex curation Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chikashige Y., Tsutsumi C., Yamane M., Okamasa K., Haraguchi T., Hiraoka Y. 4C yasushi@nict.go.jp Accepted 2006-MAY-17 by DAVET. Cell (0092-8674) 2006 1352..1356 1352..1366 2006-07-13: Only interaction involving solely Proteins were exported. Only protein-protein interactions 11 imex curation rap1_schpo DNA-binding protein rap1 rap1 SPBC1778.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFTFTKSDGSSILFAVSKNFEHIRGFKNAIDCFKGKIEFLSFDKVDPTKHDYYLVAEDERVSDLDIPKGFFERNPEFRHKMLKIAWITQCIEQGKLLPTESFEVELNQDDVNRTHDGFRKRELFTLEDEKILIDHVHKNDINRFGTKVYEELARKYPQHSLESWRQHYKYMKKRLPPVSDSDESNYCQRIIVKPYSSQKDYTQSTHEQTLSSPISKSASVSKSENKALVNNKRYSDSYFYFSKMRRISIDVDYVDEDLNLINAYLSQFGKKRSLNELCALLSRRFSNRHTFSEWRALFMHFFPFINSEGVDPAILSDRETSAMLDETSDNEVADIDDQMIERKYLFSASEPNTVKSTNRLIFSERKAYAADDSIDNTPSKVPIVNSLSDPRTNRPFFYSNPDSMYRSISNPLHLVDSQHLSPLNRKTHFNNPIGQPQFTCLDDHEKTLRETSFRSLDDMSLRKSNSDNIFVKPGEDLEIPLLSDYSDSENISEKSSDDEEAFEKQVTSSYSSPIKVKSQGKSSKGSSGLDVREHEGSDDDAEVFVDRSPESFGATKVAHTSLEGNAASHKKVEENMQQPVTKKQKKYRMVNEEAHTGPTIIIPSDNNEKVTTLPAGHVPSEEKGKFINLAMHELQNEVSILRSSVNHREVDEAIDNILRYTNSTEQQFLEAMESTGGRVRIAIAKLLSKQTS 77C5070697D1A9CF 77C5070697D1A9CF bqt1_schpo Telomere bouquet protein 1 bqt1 Meiotic chromosome segregation protein bqt1 Meiotic recombination protein rec26 Meiotically up-regulated gene 23 protein mug23 rec26 SPAC6G9.13c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MHLLTTTLISFEQNKVEYLTQIAIYTQTPVCTDSNCEHARFLKHSLIQVSIERIEYLYSIFPNIWQFALLCQGQNKESLIHMEEDASTNFKLRYYVLPWSRRLQGYQSITVQNGSHVPLVKRLEKWRIFVEC 03E082A24921F62A bqt2_schpo Telomere bouquet protein 2 bqt2 Meiotic chromosome segregation protein bqt2 Meiotically up-regulated gene 18 protein mug18 SPAC1002.06c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFQGKCAFFDETVPSALIALWQLHNGEAKFLAEGYENFDYAFSMHLRKHVRLPNYKSVQCRSPWWIAEQVAVSRSKSYVSEPVIHLNVMEPLYVDHRIRSVYLQPLPSTLSFLNGELP 29331F2A72640933 sad1_schpo Spindle pole body-associated protein sad1 sad1 SPBC12D12.01 SPBC16H5.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFTNTPVGGKRERQNGAHPAWSTLGANSAQIHQNTADLASKMHKLRYTKIRSPPTRVSIESITPKQRFPAPNFEQAYHSNIRYEQEESDNEEFENVVKNGHEASTNVFYESDGDDEEFVNEEYENSIDEESDDEGYSLNEDTTATNASFRYPMNQRSTRKSQFYSSKFKPLLWFGITLFSTLLIITLLHKGQEFYSRSFSSDNSQPSNSPVPNIPPASNDTKTSLKPDIIKDFTDSPSKVGGNEEFDYSTGDLITKKEFDKILQQKVEQLKQSLKEEMSNYKSSVPFEVELNDDWKFFIESTVRKYLTDPVSMPNFALLSTGAEVLPALTSKRYVRRPSAFIPRFTSYFFDSLVVRGHEPSIALTPNNAVAMCWSFQGSEGQLGISLSRPVYVTNVTIEHVQHKIAHDLSSAPKDFELWVQGMSSKMFVLLGKARYSLTEDSIQTFSFESSNYIVAEPIQNVILKIKSNWGNPNYTCLYQVRVHGTVPNADEQPIPSLGEKAESTAENTGQDSS DCA4CAC1E1F98F0D bqt1-bqt2 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association bqt1-bqt2-1 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association bqt1-bqt2-2 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association bqt1-sad1 3 9 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association bqt1-rap1 4 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role ancillary ancillary 7 unspecified role unspecified role bait bait physical association physical association bqt1-rap1-1 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role ancillary ancillary 6 unspecified role unspecified role prey prey physical association physical association bqt1-sad1-1 2 9 unspecified role unspecified role neutral component neutral component rfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association bqt2-sad1 2 9 unspecified role unspecified role neutral component neutral component rfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association This interaction is only observed in the cells expressing Bqt1. bqt2-sad1-1 2 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component rfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component cfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association This interaction was observed only in cells expressing Bqt2. bqt1-sad1-2 2 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component rfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Q09825 overexpressed bqt2-rap1 5 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association This interaction is only observed in the cells expressing Bqt1.